KEGG   Viruses: 14515755
Entry
14515755          CDS       T40000                                 

Gene name
H390_gp25
Definition
(RefSeq) Xanthomonas citri phage CP2; hypothetical protein
Taxonomy
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; unclassified Podoviridae
Organism
vg  Viruses (Xanthomonas citri phage CP2)
SSDB
Motif
Pfam: LPD22 Acetyltransf_7
Other DBs
NCBI-GeneID: 14515755
NCBI-ProteinID: YP_007392914
RS: NC_020205
UniProt: K7ZRM7
Position
NC_020205:21566..29002
AA seq 2478 aa
MGKYSEIIAATQAEDAQARARAAGITAPQVEPDAMGRAMRLADQRGLPPGVVADNLPEYD
QQQQLDALGDAASASPALARWLGDPNHTALSKDDTGVLAGLGRQFNSGLLSAKETLPWLP
LPQSALDLDKERKAAAARGPQMMASPDPSWFSELVGKFQSGWEQGKAGAGLLPMPDLGSA
SSRAIEEQVARGLGYQDAANYDATRTAVYVADQQRRAQAADVETAATAAGFQEIADAEKT
KDTGKIARAVVTNPRAVMAVVAQSLGNTAPQLALSAAMPASRVVAGVTAGTGSFATEQGM
TILDVMGDAGVETSDPAAVSAFLRNKPAMEKARQKALTRGVAVGTFDALTAGFAGRLLAN
SRRTAASIGSRVVGEGLVQAGGGAAGEATAQLASEGKITSQSDILLEAAAEVPTFLAEGR
GQIAEARRAAMHNADRFDAHQEQRAISDLVNLASQSKTRERSATRFESLIRDMTSEGEDT
IYLSADGAQRLFQSANSEGGPDLGALVDADALREAIATGGEVAIPLAKYATLVTPELHAA
VADQVRLQPGGRHDLPAVSSEEIQQAIDQGLAEAQQQDARENGPAGQVYDDVVGQLLSRQ
DEQLARQNASVVQSVYRNLAERVGTDAWTLYQQFKIRIPGATTDTRARPRGVDIDVDPFL
DALRSGKMPTDREIYGDTLVSALHAAGGLSDSGGELANMDAAKARPGLVNNLAGMSLDDA
LVWAYQEGFITQAPTNQQEGSYDADAPDINTLLDLLAQDLGGNPVYRPAAMNAERATFRD
RAQSLQDELDQRGIDLQQADNATARQALGYANRMLEQGQPVEPDAVDYAVRDLVAGPSGR
PESAATRALVDQAVADGDLAKMLQGIAAQEGIDADQAALALRLAEITPDLNVTMVAAPAN
ANAAGIYNNTTNEIWIHQAVPSVVLHEVLHGVTSAMMTSPTLRRSNATVARAVAEFNDLL
GAAQAHFAGMETDGADVPAALRATLQDPRGPLSNIKELLTYGMTDKRFQEWLATVPAPAG
REESRTAWQWFKDAIATMLGVTGQERTALDALIESTSDLVDFAQANPRAANFAQMSEANR
LGAPITDAAAAQGGPAEAFRGVTREQFLGEPRITSNTNAADLRPRALRELDAVDSVPFGD
GDLTAKYSDGSAAVFDGDKVVASYNFGDTLVVDRAYRRRGIGEELVYQWRTRNPQASVAR
ERTKASQALQEKVWDRIQSELAADPRTLNQGGEKPRGAVTFEGVPGARVFNIELLKGMDA
STFMHEMGHVYLEVLNDLAARDGAPAQITNDMATLNAWLGREAGTAFTVDQHEQFARGFE
AYLREGRAPSSALRRTFAAFKVWLTALYRSVRSLNVELTDDVRNVMDRIVASDAEIEDAR
AGQYQGALIADGMAVGMTFEQLQAYNEAVNAARADAEATVAAEVLLAERREQQAWYNREK
REVRTQVLEEVRNLPVYRAQRLLRNGKLPNGDLAPDELRVKLSKDELLDKFGQSFLRNLV
GMYSVEGGVRADDAAAIYGFGSGRELIESLVNAPRLADAVASETDARMKDRHPDPMTDGT
LPDRAMIAAHRDRQADVMVREIRALEQHVNGRQVSQAAVIKGVARQIIQDKKLRHLQPAT
YRSAEAKAGREAFEAAAKQDWGSALAARRRQLLNFELFREAVRARDEAARTAKYLAKFSE
TKTRARLGKAGADYLDQVDGLLDRFDFRKISDKAADRRSSLATWIEVQAQKGIDVNLPPK
IMDEAFTIPYREMTVADLATLRDAIRSIDHLARLKGKLLLAGEVRDAAEVDAAMAASLAA
AHAARPVTTGDRGPKDKLRQAFMQGRVIQATATDMARELDGFKDQGAIWMNTVGVMRDAV
NNRLNPALQQAQDDLAKVYVKHYTKAEIRGFSERVPMPEVNGDLWSKSRLLGLALNWGNA
GNREAILTQARGRMSSEQVNALLSKLDSRDWAFVEDVWRLIDAQWPAIAEAQKRRTGLVP
ERVQASAFTVQTSDGKTLQIPGGYYPLKYESDSVKTMKDEADDFYNSIRTGRTAKAATRN
GHTIERVGSGGRTVRLDTGVVQQHLRDVLRDVHLGDAVNYVHNVLNGQEFKEAVDSTGMQ
EYRQALEVWLKDAAAGEIGPRVWHERAMRAARQNFTASVLTFKVTSALLQLSGVVPTIVT
IGQGHTMAGIGQYLGKPRAMTRYVREASPYMDSRLRTHIEAVQTVMDAEAGRFAAGKAAS
IRFGYWMIGRVQGLVDTVTWLAAEQAGMAKFGNDVARARAYADDVVTRAQGSGEFIDKSP
LQRGTLGDNVRQTEWIKATTALQGYMIAKGNLAYEQTRKANLRNPRQAMKWAADMVMLFS
VEGLLTAALTAKLPKDDDDDGLWDDLGEWAIKDALSTFFGVIPGGGVLVDQFRGYDSSGV
VAGAWRAYAELLEKVTPGEDGEVNLDKGVAKAAVSAAGVTLGLPSTQVNKTIDAIAARAD
GRDVSPYEYLTGPKKESK
NT seq 7437 nt   +upstreamnt  +downstreamnt
atggggaagtattcggaaatcatcgcggcaacccaggccgaagacgcccaggcgcgcgcc
cgcgccgcgggcatcacggcgccgcaggtggagccggacgcgatgggccgggccatgcgc
ctggccgatcagcgcggcctgccgcccggcgtggtcgccgacaacctgcccgaatacgac
cagcagcagcagctggacgccctgggcgacgctgccagcgcttccccggcccttgcgcgc
tggctgggcgaccccaaccacacggcgctgtccaaggacgacacgggcgtactggcgggc
cttggacggcagttcaacagcgggctgctgtcggcgaaggaaacgctgccgtggctcccg
ctgccgcagtctgccctggacctggacaaggaacgcaaggccgccgccgcgcgcgggccg
cagatgatggccagcccggacccgtcgtggttcagcgaactggtgggcaagttccaatcc
ggttgggagcaaggcaaggcgggggccggcctgctgccgatgccggaccttggcagcgcc
agttcgcgcgcaatcgaagaacaggtggcccgcggcctggggtatcaggatgcggccaac
tacgacgcgacccgcaccgcggtgtacgtggccgaccagcagcgccgcgcgcaggccgcc
gacgtggaaaccgcggcgaccgcggccgggttccaggaaattgccgacgctgagaaaacg
aaggacaccggcaagatcgcgcgcgccgtggtcacgaatccgcgcgcggtgatggccgtg
gtggcgcagtcgctgggcaacaccgccccgcagctggcgctgtccgcggcgatgccggcc
agccgtgtcgtggccggcgtcacggcgggcaccggctcgttcgccaccgaacagggcatg
accatcttggacgtgatgggcgatgctggcgtggaaaccagcgacccggccgcggtgtcc
gccttcctgcggaacaagccggccatggagaaggcccggcagaaggcgctgacgcgcggc
gtggcggttggcacgttcgacgcgctcacggctgggtttgcggggcgcttgctggcgaat
agccgtcgcacggcggcatccatcggatcgcgtgtggtcggtgaaggcctggtgcaggct
ggcggcggcgcagcgggcgaagctaccgcgcagctggccagcgaaggcaagatcaccagc
cagtcggacattctgctggaagctgcggctgaggttcccaccttcctggccgaaggccgc
gggcagatcgcagaagcgcgccgcgcggcaatgcacaacgccgaccgcttcgacgcccac
caggaacagcgggcgatcagcgacctggtgaacctggcgtcgcagtcgaagacgcgcgag
cgttcggccacgcgcttcgaatccctcatccgggacatgaccagcgagggcgaggacacc
atctacctgtcggccgatggcgcccagcgcctgttccagtcggccaacagcgagggcggc
ccggacctgggcgccttggtggatgccgacgccctgcgcgaggccatcgctaccggtggc
gaagtcgctatcccgctggccaagtacgccaccctggtcaccccggaactgcacgcggcc
gtggccgatcaggtgcggctgcagcccggcggccgccacgatctgccggcggtgtcgtcg
gaagaaatccagcaggccatcgaccaggggctggccgaagcgcagcagcaggacgcgcgc
gagaacgggccggccggccaggtctacgacgacgtggtggggcagctgctgtcgcgccag
gacgaacagctggccaggcagaacgccagcgtggtgcagtccgtctaccgcaacctggcc
gagcgtgtgggcaccgacgcctggacgctgtaccagcagttcaagatccgcatccccggc
gcgaccaccgacacgcgcgcccgcccgcgcggcgtggacatcgacgtggacccgttcctg
gacgcgctccgcagcggcaagatgcccaccgaccgcgagatttacggcgacacgctggtg
tcggcgctgcacgcggccggtggcctgagcgactccggcggcgaactggccaacatggat
gccgccaaggcgcggccgggcctggtcaacaacctggccggcatgagcctggacgatgcc
ctggtgtgggcgtaccaggaaggcttcatcacccaggcaccgacgaaccagcaggaaggc
agctacgacgccgacgcaccggacatcaacacgctgctggatctgctggcccaggatctt
ggcggcaatccggtgtaccgccccgcggccatgaatgccgagcgcgccacgttccgcgac
cgtgcccagtcgctgcaggatgagcttgaccagcgcggcatcgacctgcagcaggcggac
aacgcgaccgcgcggcaggcgctgggatacgcgaaccgcatgctggaacagggccagccg
gtcgaacccgatgcggtggactacgccgtgcgcgacctggtggcggggccgagcggccgc
ccggaaagcgccgcgacgcgcgcgctggtggaccaggcggtggccgatggcgacctggcc
aagatgctgcagggcatcgccgcccaggaagggatcgatgccgaccaggccgcgcttgcg
ctgcgcctggctgaaatcacgcccgacctgaacgtgacgatggtggcggcaccggccaac
gccaacgccgccggcatctacaacaacaccacgaacgaaatctggatccaccaggcggtg
ccgtccgtggtgctgcacgaagtcctgcatggcgtcacgtcggcgatgatgaccagtccg
accctgcgccggtcgaacgcgaccgtggcgcgcgccgtggccgagttcaacgacttgctg
ggcgccgcccaggcccacttcgctggcatggaaaccgatggcgccgatgtgccggcggcg
ctgcgcgccacgctgcaggatccgcgcgggccgctgtcgaacatcaaggaactgctgacc
tacggcatgaccgacaagcggttccaggaatggcttgccaccgtgccggcgccggctggc
cgcgaggaatcgcgcacggcctggcagtggttcaaggacgccattgcgacgatgctgggc
gtgaccgggcaggagcgcaccgcgctggatgccttgatcgaatcgaccagcgacctggtg
gacttcgcccaggccaacccgcgcgcggccaacttcgcgcagatgagcgaggccaaccgg
ctgggcgctccgatcaccgatgcagccgctgcgcagggtggaccggcggaagcgttccgc
ggcgtcacgcgcgaacagttcctgggcgagccgcgcattacgtcgaacaccaacgctgcc
gaccttcggccgcgggcgctgcgcgaactggacgcagtggattccgtgccgttcggcgac
ggcgacctgaccgcaaagtattccgatggttcggccgccgtgttcgatggggacaaggtg
gtggccagctacaacttcggcgacacgctggtggtggatcgcgcataccgtcgccgcggc
atcggcgaagaactggtttaccagtggcgcaccaggaacccgcaggcttcggtcgcgcgc
gagcgcaccaaggcgtcgcaggctttgcaggaaaaggtgtgggaccgcatccagtccgag
cttgccgccgatcctcggaccctcaaccagggcggcgagaagccgcgcggcgccgtcacg
ttcgaaggcgtgcccggcgcgcgggtgttcaacatcgaactgctgaaaggcatggacgcc
agcaccttcatgcacgaaatggggcacgtgtacctggaagtgctgaatgacctggccgcg
cgcgatggcgcgcccgcgcagatcaccaacgacatggccaccctgaacgcctggctgggc
cgcgaggccggcaccgcgttcaccgttgaccagcacgaacagttcgcccgcggcttcgaa
gcctacctgcgcgagggccgtgcgccgtcgtctgcgctgcgccgcacgttcgccgcgttc
aaggtgtggctgaccgcgctgtaccgcagtgtgcgcagcctcaacgtggaactgaccgat
gacgtgcgcaacgtcatggaccgcatcgtggccagcgatgccgagattgaagacgcgcgc
gccggccagtaccagggggcgctgattgccgatggcatggctgtgggcatgaccttcgaa
cagctgcaggcctacaacgaggcggtgaacgcagcgcgcgccgatgccgaagccaccgtg
gcggccgaagtgctgctggccgagcggcgcgagcaacaggcgtggtacaaccgcgagaag
cgggaagtgcgcacccaggtgttggaagaggtccgcaacctgcccgtgtaccgcgcccag
cgcttgctgcgcaacggcaaactgccgaacggtgatctggcgcccgatgaactgcgcgtc
aagctgtcgaaggacgaactgctggacaagttcgggcaatcgttcctgcgcaacctggtc
ggcatgtactcggtggaaggtggcgtgcgcgccgacgatgcggccgccatctacgggttc
gggtccgggcgcgagttgatcgaatcgctggtgaacgcgccgcgtctggccgacgccgtg
gccagcgaaaccgatgcgcgcatgaaggatcggcacccggatccgatgacggacggcacg
ctgcccgaccgggcaatgattgccgcgcaccgtgaccggcaggccgacgtgatggtgcgc
gaaatccgcgcgctggaacagcacgtcaacgggcgccaggtgtcgcaggctgcggtcatc
aagggcgtggcccggcagatcatccaggacaagaagctgcgccacctgcagccggccacc
taccgttcggccgaagcgaaggccgggcgcgaggcgttcgaagccgcggcgaagcaggac
tggggttccgccctggccgcacgccgccggcagctgctgaacttcgaactgttccgcgag
gccgtgcgcgcgcgcgatgaggcggcgcgcaccgcgaagtacctggcgaagttcagcgag
acgaagacccgcgcgcggctgggcaaggccggcgccgactacctggaccaggtggatggc
ctgctggaccgcttcgacttccgcaagatcagtgacaaggcggcggaccgccgttcctcg
ctggccacctggatcgaggttcaggcgcagaaggggatcgacgtgaacctgccacccaag
atcatggacgaagcattcaccattccgtaccgcgaaatgaccgtggcggacctggccacg
ctgcgcgatgccatccggtccatcgatcacctggcgcggttgaagggcaagctgcttctg
gccggcgaagtgcgcgatgccgcggaagtggatgctgccatggccgccagcctggccgct
gcgcacgctgcgcgtccggtcactacgggcgaccgcgggccgaaggacaagctgcgccag
gcattcatgcagggccgcgtgatccaggccacggcgaccgacatggcccgcgaactggat
gggttcaaggaccagggcgccatctggatgaacaccgtgggcgtgatgcgcgatgcggtg
aacaaccggctgaacccggcgctgcagcaggcgcaggatgatctggccaaggtgtacgtg
aagcactacacgaaggcggaaatccgcggcttctccgagcgcgtgccgatgcccgaagtg
aacggcgacctgtggagcaagtcccgcctgctgggcctggcgctgaattggggtaacgcc
ggcaaccgcgaagcgatcctgacccaggcacgcgggcgcatgtcgtcggaacaggtgaac
gccctgctgtcgaagctggattcgcgcgactgggcgttcgtggaagacgtgtggcggttg
atcgatgcgcagtggcctgccatcgccgaagcgcagaagcgtcgcaccgggctggtgccg
gagcgcgtgcaggccagcgccttcacggtgcagaccagtgacggcaaaacgctgcagatc
cccggcggctactacccgttgaagtacgaatccgattccgtcaagaccatgaaggacgaa
gcggacgacttctacaacagcattcgcaccggtcgcaccgccaaggccgccacgcgcaac
gggcacaccatcgagcgcgtcggttcgggtgggcgcactgtgcgcctggacacgggcgtg
gtgcagcagcacctgcgcgacgtgctgcgcgatgtccacctgggcgatgccgtcaactac
gtccacaacgtgctgaacggccaggaattcaaggaagccgtggacagcaccggcatgcag
gaataccggcaggcgctggaagtgtggttgaaggatgcggcggccggcgagattggcccg
cgcgtgtggcacgaacgcgccatgcgcgccgcgcgccagaacttcaccgcctccgtgctg
acgttcaaggtgaccagtgcgctgctgcagttgtcgggcgtcgtgcccaccatcgtcacc
atcggtcaggggcacaccatggccggcatcggccagtacctgggcaagccgcgcgcgatg
acgcgctacgtgcgcgaggcgtcgccgtacatggacagccgcctgcgcacgcacatcgaa
gcggtgcagaccgtgatggatgcggaagccggccggttcgccgcgggcaaggccgccagc
atccggttcggttactggatgatcggccgcgtgcaggggctggtggacaccgtgacctgg
ctggcagcagaacaggcgggcatggcgaagttcggcaacgacgtggcgcgcgcgcgggcc
tacgccgacgacgtggtgacgcgcgcccagggttcgggcgagttcatcgacaagtcgccg
ctgcagcgcggcacgctgggcgacaacgtgcgccaaaccgagtggatcaaggcgaccacc
gcgctgcagggctacatgatcgcaaaggggaatctggcctacgaacagacccgcaaggcg
aatctgcgcaacccgcgccaggcgatgaagtgggccgccgacatggtgatgctgttctcg
gtcgaaggcctgctgaccgcggcgctgaccgccaagctgccgaaggacgacgacgacgac
ggcctgtgggatgacctgggcgagtgggccatcaaggatgcgctgtccaccttcttcggc
gtgatccctggcggcggcgtgctggtggaccagttccgcggctacgattccagcggcgtg
gtggccggcgcctggcgcgcctacgccgaactgctggaaaaggtgacccccggcgaggat
ggcgaagtgaacctggacaagggcgtggcgaaggcggccgtgtccgcggccggcgtcacg
ctgggcctgccatccacccaggtcaataagaccatcgacgccatcgcggcgcgcgcggac
ggccgcgacgtgtcgccctacgaatacctgaccggccccaagaaggaatccaaataa

DBGET integrated database retrieval system