KEGG   Viruses: 1461081Help
Entry
1461081           CDS       T40000                                 

Gene name
ORF26, EhV2gp26
Definition
(RefSeq) Equid gammaherpesvirus 2; capsid triplex subunit 2
Taxonomy
TAX:12657
  Lineage
Viruses; dsDNA viruses, no RNA stage; Herpesvirales; Herpesviridae; Gammaherpesvirinae; Percavirus
Taxonomy
Organism
vg  Viruses (Equid gammaherpesvirus 2)
SSDB OrthologParalogGFIT
Motif
Pfam: Herpes_V23
Motif
Other DBs
NCBI-GeneID: 1461081
NCBI-ProteinID: NP_042622
RS: NC_001650
UniProt: Q66629 A0A0B4Q5C8
Position
NC_001650:74262..75164
AA seq 300 aa AA seqDB search
MQVDSRIVVTLTSRLYADEISKLQERVGSVVPLKDSHRLQNLNSVGMYSVYMRNVAPDFV
AMFSYLSEATLAILDEVTPDTLVFSRLDHSQNYELKNVYYPSFAWHSHTLLTVVPPVFGR
EAATVALESNGFEIVFPVVMPHALAQAVLQKLMLYNIYARLSDANVGDVNMDHVRFHATT
LHHMGRAYTLHIDQANPGGMLGLLDNLAIYLAIISALLPNSLARLLPAIMRHEQHELLNI
FAGVAPPDDGGDFNIEDDMQKMESFMAYMQSVSSIFNLGPKLRLGQYSSETQSGTAWLAS
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtagacagcaggatagtggtgaccctcacctccaggctctacgcggacgagata
tccaagctccaggagagggtgggctctgtggtacccctcaaggactcccacaggctgcag
aacctcaactccgtgggcatgtacagcgtctacatgaggaacgtggccccggacttcgtg
gccatgttctcctacctctccgaggccaccctggccatcctggacgaggtcacccccgac
accctggtcttctcccgcctcgaccactcccagaactacgagctcaagaacgtgtactac
ccctccttcgcgtggcactcccacaccctcctcaccgtggtgcccccggtgtttggcagg
gaggccgccaccgtggccctagagtccaacgggttcgagattgtctttcccgtggtgatg
ccccacgccctggctcaggcggtgctgcagaagctgatgctgtacaacatctacgcgagg
ctgagcgacgccaacgtgggggacgtgaacatggaccacgtgaggttccacgcgaccacc
ctgcaccacatgggcagggcctacacgctgcacatagaccaggccaacccgggcggcatg
ctgggcctgctggataacctggccatctacctggccatcatcagcgccctgctgcccaac
tccctggccaggctcctgccggccatcatgaggcacgagcagcacgagctgctgaacatc
ttcgcgggggtcgcgcccccggacgacgggggagatttcaacatagaagatgatatgcaa
aagatggagtccttcatggcctacatgcagtccgttagctcaatatttaatttgggtccc
aagctgaggctgggacaatactcctctgaaacgcagagcgggaccgcctggctcgcgtcc
tga

DBGET integrated database retrieval system