KEGG   Viruses: 1486457
Entry
1486457           CDS       T40000                                 

Gene name
K2L, VARVgp056
Definition
(RefSeq) Variola virus; IMV membrane protein
Taxonomy
TAX:10255 [GN:T40082]
  Lineage
Viruses; dsDNA viruses; Poxviridae; Chordopoxvirinae; Orthopoxvirus
Organism
vg  Viruses (Variola virus)
SSDB
Motif
Pfam: Pox_EPC_I2-L1 CoV_S2 vMSA DUF3671 DUF2207 ATG27 zf-LITAF-like DUF5542
Other DBs
NCBI-GeneID: 1486457
NCBI-ProteinID: NP_042100
RS: NC_001611
UniProt: P0DOR3 P0DOR4 Q0N590 Q0NCR5 Q0NG82 Q0NLZ7
Position
NC_001611:complement(51624..51845)
AA seq 73 aa
MDKLYAAIFGVFMGSPEDDLTDFIEIVKSVLSDEKTVTSTNNTGCWGWYWLIIIFFIVLI
LLLLIYLYLKVVW
NT seq 222 nt   +upstreamnt  +downstreamnt
atggataagttgtacgccgctatatttggtgtatttatgggttctccggaagatgatttg
acagactttatagaaattgttaaatctgttctaagtgatgagaaaactgtcacatcaact
aataataccggttgttggggttggtattggttaattattattttttttatagttcttatt
ctactactattgatatatttgtatttaaaagttgtttggtga

DBGET integrated database retrieval system