KEGG   Viruses: 1486605Help
Entry
1486605           CDS       T40000                                 

Gene name
FPV057
Definition
(RefSeq) Fowlpox virus; Early transcription factor small subunit
Taxonomy
TAX:10261
  Lineage
Viruses; dsDNA viruses; Poxviridae; Chordopoxvirinae; Avipoxvirus
Taxonomy
Organism
vg  Viruses (Fowlpox virus)
SSDB OrthologParalogGFIT
Motif
Pfam: ResIII Helicase_C SNF2_N SWI2_SNF2 Zot AAA_22 DEAD_2
Motif
Other DBs
NCBI-GeneID: 1486605
NCBI-ProteinID: NP_039020
RS: NC_002188
UniProt: P21966
Position
NC_002188:complement(60534..62435)
AA seq 633 aa AA seqDB search
MNLEILELFNGHIDNIPNILPHQLATLDYLLRTILDHNESVLLFHIMGSGKTIIALLFAL
IVSKFKKVYILVPNINILNIFTYNLDLATNLINTEYVIENIHIYSTINFYSLNYNDNVVN
YNALSKYNDSIFIIDEAHNIFGNNTGELMTIIKNKNKVPFLLLSGSPITNTPITLSNIIS
IMSDEGINFNDIIIQGKKVFQIILNEKGVSVLKNILKNKISYYELCDTELPSIIFHGKEF
LDTKVVYCKMSKLQETDYINVRKLCNNEMFEKNMTNVSLAVLGPLNLANSLELLFVEQDK
ELYPNLKINDGVLYGDELTKLNISSKFKYFIDTIGNLTGKNFIYFSNSTYGGLVIKYIML
NNGYSEYAGSQGTNPKMINGHLKTFAIVTSKMKSSLEDLLEVYNSPGNDNGEKIMFLFSS
NIMSESYTLKEVRNIWFMTIPDTFSQYNQILGRSIRKFSYKDVSKPVNVYLLATVYSDFN
DTITSLDDYSIDDINTLPFDIKKLLYLKFKTKETKRIYSILKDLSINYRSSPHPYITDVV
LGELVRQFFYHNSRVSINDAKLFKMVNSIFKSKEKTQKYIEKITDDHFFVTNKVFEKSLL
YKHKNDIIVVPFNLLFTEYSWMINFRKELNVVV
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgaacctagaaatacttgaactctttaatgggcacatagataacattcctaatatctta
cctcatcaattagctaccttggattatcttttaaggactatactagatcataatgaaagt
gttttgttgtttcatattatggggtcagggaaaactattatagcactgctatttgcactt
atcgtgtcaaagtttaaaaaggtttacatattggtacctaatattaatatacttaatata
tttacgtataatttagatttggcaactaatctcatcaatacagaatatgttattgaaaat
attcatatttattcgacgattaatttctatagtcttaactacaacgataatgtagtgaac
tacaatgctttatctaagtacaacgactctattttcatcatagacgaggctcataacata
ttcggaaacaatacaggtgaattaatgactattattaaaaataagaataaggtacctttt
cttttactatcagggtctcctatcactaatacacctattacactatctaatattattagt
attatgtcggatgaaggtataaactttaacgatattataatccagggaaagaaagtattt
cagataatattaaacgaaaaaggtgtaagcgtattaaaaaatattctgaagaataagata
tcctactatgaattatgtgatacggaactaccgagtatcatctttcacggtaaagagttt
ttagatacgaaagtagtttattgtaaaatgtctaaactacaggaaactgactacataaac
gtacggaaattgtgcaataatgaaatgtttgaaaaaaacatgacaaatgtttctttagct
gtattaggacctttgaatttggctaatagtttagaactgttattcgtagaacaggataaa
gaactttatcctaatttgaaaataaacgacggtgtcttatacggagacgaattaactaaa
cttaatataagctcaaaatttaaatattttatagatactatcgggaatcttacgggtaaa
aattttatctatttttctaattctacatacggtggattagtcatcaagtatatcatgctt
aacaacggatattctgaatacgccggttcgcaaggtaccaatccaaaaatgataaacgga
catcttaaaacatttgctatagtcacgagtaaaatgaagtcatccttagaagatttattg
gaagtgtataattccccagggaatgataacggagaaaagattatgtttttattttcctcc
aatattatgtcagaatcatatactttgaaggaagtaagaaacatctggtttatgactata
cctgatactttttcacaatacaatcagattttgggtagatctattagaaagttctcgtat
aaagatgtttcgaaacctgttaacgtatacctattagctacggtttattcagattttaac
gatacaataacttctctagatgattatagtatagatgatataaatactttaccattcgat
atcaaaaaactactttatctaaagtttaaaacgaaagaaacaaaacgaatttattccata
ctaaaagatctatctataaactatagatcatcaccccatccttatataacggatgttgta
ttaggcgagctggttagacaatttttttaccacaattctagagtaagtataaacgatgct
aaactttttaaaatggtaaatagtatttttaaatccaaagaaaaaacacaaaaatatata
gagaagataacagacgaccatttcttcgttactaataaagtatttgaaaaatcattgtta
tataaacataaaaatgatattatagtagtacctttcaatctattgtttacagaatattct
tggatgattaattttagaaaggaactaaatgtcgttgtttaa

DBGET integrated database retrieval system