KEGG   Viruses: 1487307
Entry
1487307           CDS       T40000                                 

Gene name
UL23, HHV2p53
Definition
(RefSeq) Human alphaherpesvirus 2; thymidine kinase
Taxonomy
TAX:10310 [GN:T40074]
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Alphaherpesvirinae; Simplexvirus
Organism
vg  Viruses (Human alphaherpesvirus 2)
SSDB
Motif
Pfam: Herpes_TK AAA_33 AAA_28 Thymidylate_kin AAA_14 AAA_5 RNA_helicase AAA_18 AAA_16 dNK AAA_22 CbiA ResIII
Other DBs
NCBI-GeneID: 1487307
NCBI-ProteinID: YP_009137174
RS: NC_001798
UniProt: P89446 Q6L709
Position
NC_001798:complement(46909..48039)
AA seq 376 aa
MASHAGQQHAPAFGQAARASGPTDGRAASRPSHRQGASGARGDPELPTLLRVYIDGPHGV
GKTTTSAQLMEALGPRDNIVYVPEPMTYWQVLGASETLTNIYNTQHRLDRGEISAGEAAV
VMTSAQITMSTPYAATDAVLAPHIGGEAVGPQAPPPALTLVFDRHPIASLLCYPAARYLM
GSMTPQAVLAFVALMPPTAPGTNLVLGVLPEAEHADRLARRQRPGERLDLAMLSAIRRVY
DLLANTVRYLQRGGRWREDWGRLTGVAAATPRPDPEDGAGSLPRIEDTLFALFRVPELLA
PNGDLYHIFAWVLDVLADRLLPMHLFVLDYDQSPVGCRDALLRLTAGMIPTRVTTAGSIA
EIRDLARTFAREVGGV
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggcttctcacgccggccaacagcacgcgcctgcgttcggtcaggctgctcgtgcgagc
gggcctaccgacggccgcgcggcgtcccgtcctagccatcgccagggggcctccggagcc
cgcggggatccggagctgcccacgctgctgcgggtttatatagacggaccccacggggtg
gggaagaccaccacctccgcgcagctgatggaggccctggggccgcgcgacaatatcgtc
tacgtccccgagccgatgacttactggcaggtgctgggggcctccgagaccctgacgaac
atctacaacacgcagcaccgtctggaccgcggcgagatatcggccggggaggcggcggtg
gtaatgaccagcgcccagataacaatgagcacgccttatgcggcgacggacgccgttttg
gctcctcatatcgggggggaggctgtgggcccgcaagccccgcccccggccctcaccctt
gttttcgaccggcaccctatcgcctccctgctgtgctacccggccgcgcggtacctcatg
ggaagcatgaccccccaggccgtgttggcgttcgtggccctcatgcccccgaccgcgccc
ggcacgaacctggtcctgggtgtccttccggaggccgaacacgccgaccgcctggccaga
cgccaacgcccgggcgagcggcttgacctggccatgctgtccgccattcgccgtgtctac
gatctactcgccaacacggtgcggtacctgcagcgcggcgggaggtggcgggaggactgg
ggccggctgacgggggtcgccgcggcgaccccgcgccccgaccccgaggacggcgcgggg
tctctgccccgcatcgaggacacgctgtttgccctgttccgcgttcccgagctgctggcc
cccaacggggacttgtaccacatttttgcctgggtcttggacgtcttggccgaccgcctc
cttccgatgcatctatttgtcctggattacgatcagtcgcccgtcgggtgtcgagacgcc
ctgttgcgcctcaccgccgggatgatcccaacccgcgtcacaaccgccgggtccatcgcc
gagatacgcgacctggcgcgcacgtttgcccgcgaggtggggggagtttag

DBGET integrated database retrieval system