KEGG   Viruses: 1488995
Entry
1488995           CDS       T40000                                 

Gene name
L1, EEPVgp13
Definition
(RefSeq) Deltapapillomavirus 1; major capsid protein
Taxonomy
TAX:10565
  Lineage
Viruses; dsDNA viruses; Monodnaviria; Shotokuvirae; Cossaviricota; Papovaviricetes; Zurhausenvirales; Papillomaviridae; Firstpapillomavirinae; Deltapapillomavirus
Organism
vg  Viruses (Deltapapillomavirus 1)
SSDB
Motif
Pfam: Late_protein_L1
Other DBs
NCBI-GeneID: 1488995
NCBI-ProteinID: NP_041313
RS: NC_001524
UniProt: P11326
Position
NC_001524:6034..7539
AA seq 501 aa
MAFWQPSQRLYLPPTPVTKVLCSEQYIRRKDVFYHGETERMLTVGHPYYEIKQSGSGKTI
PKVSPNQYRVFRILLPDPNQFALPDKAMYDPSKERLVWAVVGVQVSRGQPLGGSVSGHSY
QNTLIDAENVSKKVNAQGTDDRKQGGMDVKQQQILLLGCTPAIGEYWTTARPCVTDRPET
GSCPPIELKNKPIEDGDMMDIGFGAANFKELNATKSDLPLDIAKDICLYPDYLKMTEEAA
GNSMFFFARKEQVYVRHIWSRGGTDKEMPPEAYFLKPKGGDQTQKMPSILFGVPSGSLVS
TDGQLFNRPYWLFRAQGMNNGICWLNQLFVTVGDNTRGTTLTITVPTSGSPLTEYDTSKF
NVFQRHVEEYKLAFVFQLCSVTLSPETVSHLQGLMPSILEHWDINMQPPTSSILEDTYRY
LESPATKCADNVTPMGPEDPYAGLKFWEVNLKERLSLDLDQFPLGRRFLAQQGLGCSTRK
RVAPVPKVTEKRIVRKRRKGN
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggcgttctggcagcctagtcaaaggctatacctgcctcccacacctgtgacaaaggtg
ctgtgctctgagcaatatattaggcgtaaggacgtattttatcacggggagacggagcgc
atgctcactgtagggcatccatattatgaaattaaacaatcagggtctgggaaaaccatt
ccaaaggtttcacctaatcaatatcgtgtttttcggatcttactgccggatcccaaccag
tttgctcttccagataaagccatgtatgacccaagtaaggaaaggctagtctgggctgtt
gtgggggtacaggtgtctagaggacaacctttaggtggctctgtttcaggacattcgtat
cagaacactctgattgatgcggagaatgttagtaaaaaggtaaatgcacagggcacagat
gacaggaagcagggaggcatggacgtcaagcaacagcaaattctactgctaggatgcacc
ccagctattggtgagtattggacaactgctaggccctgcgttacagataggccagagact
ggctcctgcccccctatagaactaaaaaacaaacctatagaagatggtgatatgatggat
attggctttggtgcagctaatttcaaagagttaaatgccacaaagtcagatctcccttta
gatattgcaaaagatatttgtttgtatcctgattatttaaagatgactgaagaagcggct
ggcaacagtatgtttttttttgctcggaaagaacaagtttatgttcgccacatctggtcg
cgtgggggtaccgacaaagaaatgcctccagaggcatactttctgaagccaaagggtggg
gaccaaacacagaaaatgcctagtattctttttggagtgccaagtggcagtttagtttct
acagatggacaattgtttaatagaccttactggctgtttcgtgcacagggcatgaataat
ggcatatgctggcttaatcaactgtttgttactgttggtgacaatacaagaggaaccaca
ttaaccattacggtgcctacatccgggtccccactcactgaatatgacacgagcaaattt
aatgtttttcaaaggcatgttgaagaatataagcttgcctttgtatttcagctttgctct
gtcactctaagtccagaaaccgtctcacatctccaggggttaatgccttcgatcctggaa
cactgggatattaacatgcagcctcctacgtcctcgattcttgaggatacttacagatat
cttgaatcacctgctactaaatgtgcagataatgtaacccctatgggacctgaagatccc
tatgctggtttaaagttttgggaggtgaatctaaaagaaaggttgtctcttgatcttgat
caatttcctctgggacggcgttttcttgcgcagcaaggattagggtgcagtactagaaag
agggttgcacctgtccctaaggtcaccgaaaaaaggattgttaggaaaagaagaaagggg
aattaa

DBGET integrated database retrieval system