KEGG   Viruses: 1489078
Entry
1489078           CDS       T40000                                 

Symbol
E6, HpV16gp1
Name
(RefSeq) Human papillomavirus type 16; transforming protein E6
  KO
K21807  HPV protein E6
Taxonomy
TAX:333760 [GN:T40087]
  Lineage
Viruses; dsDNA viruses; Monodnaviria; Shotokuvirae; Cossaviricota; Papovaviricetes; Zurhausenvirales; Papillomaviridae; Firstpapillomavirinae; Alphapapillomavirus; Alphapapillomavirus 9
Organism
vg  Viruses (Alphapapillomavirus 9)
SSDB
Motif
Pfam: E6
Other DBs
NCBI-GeneID: 1489078
NCBI-ProteinID: NP_041325
RS: NC_001526
UniProt: P03126 Q547J2 A0A384KQK8 A0A2D1LVN5 A0A2D1LVU2 A0A2D1LVU7
Structure
Position
NC_001526:7125..7601
AA seq 158 aa
MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIV
YRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPE
EKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL
NT seq 477 nt   +upstreamnt  +downstreamnt
atgcaccaaaagagaactgcaatgtttcaggacccacaggagcgacccagaaagttacca
cagttatgcacagagctgcaaacaactatacatgatataatattagaatgtgtgtactgc
aagcaacagttactgcgacgtgaggtatatgactttgcttttcgggatttatgcatagta
tatagagatgggaatccatatgctgtatgtgataaatgtttaaagttttattctaaaatt
agtgagtatagacattattgttatagtttgtatggaacaacattagaacagcaatacaac
aaaccgttgtgtgatttgttaattaggtgtattaactgtcaaaagccactgtgtcctgaa
gaaaagcaaagacatctggacaaaaagcaaagattccataatataaggggtcggtggacc
ggtcgatgtatgtcttgttgcagatcatcaagaacacgtagagaaacccagctgtaa

DBGET integrated database retrieval system