KEGG   Viruses: 1489668Help
Entry
1489668           CDS       T40000                                 

Gene name
S, sars2
Definition
(RefSeq) Severe acute respiratory syndrome-related coronavirus; E2 glycoprotein precursor
  KO
K19254  Coronaviridae spike glycoprotein
Taxonomy
TAX:694009 [GN:T40069]
  Lineage
Viruses; ssRNA viruses; Nidovirales; Cornidovirineae; Coronaviridae; Orthocoronavirinae; Betacoronavirus; Sarbecovirus
Taxonomy
Organism
vg  Viruses (Severe acute respiratory syndrome-related coronavirus)
SSDB OrthologParalogGFIT
Motif
Pfam: Corona_S2 Spike_rec_bind Spike_NTD MukF_M Baculo_PEP_C DUF4600 DUF1664 DUF3418 SHE3 DUF4795 DUF2959 TRPM_tetra KxDL DUF16
Motif
Other DBs
NCBI-GeneID: 1489668
NCBI-ProteinID: NP_828851
RS: NC_004718
UniProt: P59594
Structure
PDB: 

Position
NC_004718:21492..25259
AA seq 1255 aa AA seqDB search
MFIFLLFLTLTSGSDLDRCTTFDDVQAPNYTQHTSSMRGVYYPDEIFRSDTLYLTQDLFL
PFYSNVTGFHTINHTFGNPVIPFKDGIYFAATEKSNVVRGWVFGSTMNNKSQSVIIINNS
TNVVIRACNFELCDNPFFAVSKPMGTQTHTMIFDNAFNCTFEYISDAFSLDVSEKSGNFK
HLREFVFKNKDGFLYVYKGYQPIDVVRDLPSGFNTLKPIFKLPLGINITNFRAILTAFSP
AQDIWGTSAAAYFVGYLKPTTFMLKYDENGTITDAVDCSQNPLAELKCSVKSFEIDKGIY
QTSNFRVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTF
FSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCV
LAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLND
YGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNFNFNGLTGTGVLTP
SSKRFQPFQQFGRDVSDFTDSVRDPKTSEILDISPCAFGGVSVITPGTNASSEVAVLYQD
VNCTDVSTAIHADQLTPAWRIYSTGNNVFQTQAGCLIGAEHVDTSYECDIPIGAGICASY
HTVSLLRSTSQKSIVAYTMSLGADSSIAYSNNTIAIPTNFSISITTEVMPVSMAKTSVDC
NMYICGDSTECANLLLQYGSFCTQLNRALSGIAAEQDRNTREVFAQVKQMYKTPTLKYFG
GFNFSQILPDPLKPTKRSFIEDLLFNKVTLADAGFMKQYGECLGDINARDLICAQKFNGL
TVLPPLLTDDMIAAYTAALVSGTATAGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYE
NQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLN
DILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSK
RVDFCGKGYHLMSFPQAAPHGVVFLHVTYVPSQERNFTTAPAICHEGKAYFPREGVFVFN
GTSWFITQRNFFSPQIITTDNTFVSGNCDVVIGIINNTVYDPLQPELDSFKEELDKYFKN
HTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYVWL
GFIAGLIAIVMVTILLCCMTSCCSCLKGACSCGSCCKFDEDDSEPVLKGVKLHYT
NT seq 3768 nt NT seq  +upstreamnt  +downstreamnt
atgtttattttcttattatttcttactctcactagtggtagtgaccttgaccggtgcacc
acttttgatgatgttcaagctcctaattacactcaacatacttcatctatgaggggggtt
tactatcctgatgaaatttttagatcagacactctttatttaactcaggatttatttctt
ccattttattctaatgttacagggtttcatactattaatcatacgtttggcaaccctgtc
ataccttttaaggatggtatttattttgctgccacagagaaatcaaatgttgtccgtggt
tgggtttttggttctaccatgaacaacaagtcacagtcggtgattattattaacaattct
actaatgttgttatacgagcatgtaactttgaattgtgtgacaaccctttctttgctgtt
tctaaacccatgggtacacagacacatactatgatattcgataatgcatttaattgcact
ttcgagtacatatctgatgccttttcgcttgatgtttcagaaaagtcaggtaattttaaa
cacttacgagagtttgtgtttaaaaataaagatgggtttctctatgtttataagggctat
caacctatagatgtagttcgtgatctaccttctggttttaacactttgaaacctattttt
aagttgcctcttggtattaacattacaaattttagagccattcttacagccttttcacct
gctcaagacatttggggcacgtcagctgcagcctattttgttggctatttaaagccaact
acatttatgctcaagtatgatgaaaatggtacaatcacagatgctgttgattgttctcaa
aatccacttgctgaactcaaatgctctgttaagagctttgagattgacaaaggaatttac
cagacctctaatttcagggttgttccctcaggagatgttgtgagattccctaatattaca
aacttgtgtccttttggagaggtttttaatgctactaaattcccttctgtctatgcatgg
gagagaaaaaaaatttctaattgtgttgctgattactctgtgctctacaactcaacattt
ttttcaacctttaagtgctatggcgtttctgccactaagttgaatgatctttgcttctcc
aatgtctatgcagattcttttgtagtcaagggagatgatgtaagacaaatagcgccagga
caaactggtgttattgctgattataattataaattgccagatgatttcatgggttgtgtc
cttgcttggaatactaggaacattgatgctacttcaactggtaattataattataaatat
aggtatcttagacatggcaagcttaggccctttgagagagacatatctaatgtgcctttc
tcccctgatggcaaaccttgcaccccacctgctcttaattgttattggccattaaatgat
tatggtttttacaccactactggcattggctaccaaccttacagagttgtagtactttct
tttgaacttttaaatgcaccggccacggtttgtggaccaaaattatccactgaccttatt
aagaaccagtgtgtcaattttaattttaatggactcactggtactggtgtgttaactcct
tcttcaaagagatttcaaccatttcaacaatttggccgtgatgtttctgatttcactgat
tccgttcgagatcctaaaacatctgaaatattagacatttcaccttgcgcttttgggggt
gtaagtgtaattacacctggaacaaatgcttcatctgaagttgctgttctatatcaagat
gttaactgcactgatgtttctacagcaattcatgcagatcaactcacaccagcttggcgc
atatattctactggaaacaatgtattccagactcaagcaggctgtcttataggagctgag
catgtcgacacttcttatgagtgcgacattcctattggagctggcatttgtgctagttac
catacagtttctttattacgtagtactagccaaaaatctattgtggcttatactatgtct
ttaggtgctgatagttcaattgcttactctaataacaccattgctatacctactaacttt
tcaattagcattactacagaagtaatgcctgtttctatggctaaaacctccgtagattgt
aatatgtacatctgcggagattctactgaatgtgctaatttgcttctccaatatggtagc
ttttgcacacaactaaatcgtgcactctcaggtattgctgctgaacaggatcgcaacaca
cgtgaagtgttcgctcaagtcaaacaaatgtacaaaaccccaactttgaaatattttggt
ggttttaatttttcacaaatattacctgaccctctaaagccaactaagaggtcttttatt
gaggacttgctctttaataaggtgacactcgctgatgctggcttcatgaagcaatatggc
gaatgcctaggtgatattaatgctagagatctcatttgtgcgcagaagttcaatggactt
acagtgttgccacctctgctcactgatgatatgattgctgcctacactgctgctctagtt
agtggtactgccactgctggatggacatttggtgctggcgctgctcttcaaatacctttt
gctatgcaaatggcatataggttcaatggcattggagttacccaaaatgttctctatgag
aaccaaaaacaaatcgccaaccaatttaacaaggcgattagtcaaattcaagaatcactt
acaacaacatcaactgcattgggcaagctgcaagacgttgttaaccagaatgctcaagca
ttaaacacacttgttaaacaacttagctctaattttggtgcaatttcaagtgtgctaaat
gatatcctttcgcgacttgataaagtcgaggcggaggtacaaattgacaggttaattaca
ggcagacttcaaagccttcaaacctatgtaacacaacaactaatcagggctgctgaaatc
agggcttctgctaatcttgctgctactaaaatgtctgagtgtgttcttggacaatcaaaa
agagttgacttttgtggaaagggctaccaccttatgtccttcccacaagcagccccgcat
ggtgttgtcttcctacatgtcacgtatgtgccatcccaggagaggaacttcaccacagcg
ccagcaatttgtcatgaaggcaaagcatacttccctcgtgaaggtgtttttgtgtttaat
ggcacttcttggtttattacacagaggaacttcttttctccacaaataattactacagac
aatacatttgtctcaggaaattgtgatgtcgttattggcatcattaacaacacagtttat
gatcctctgcaacctgagcttgactcattcaaagaagagctggacaagtacttcaaaaat
catacatcaccagatgttgatcttggcgacatttcaggcattaacgcttctgtcgtcaac
attcaaaaagaaattgaccgcctcaatgaggtcgctaaaaatttaaatgaatcactcatt
gaccttcaagaattgggaaaatatgagcaatatattaaatggccttggtatgtttggctc
ggcttcattgctggactaattgccatcgtcatggttacaatcttgctttgttgcatgact
agttgttgcagttgcctcaagggtgcatgctcttgtggttcttgctgcaagtttgatgag
gatgactctgagccagttctcaagggtgtcaaattacattacacataa

DBGET integrated database retrieval system