KEGG   Viruses: 1489669
Entry
1489669           CDS       T40000                                 

Gene name
ORF3a, sars3a
Definition
(RefSeq) SARS coronavirus Tor2; ORF3a protein
  KO
K24579  SARS coronavirus accessory protein 3a
Taxonomy
TAX:227984 [GN:T40069]
  Lineage
Viruses; +ssRNA viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes; Nidovirales; Cornidovirineae; Coronaviridae; Orthocoronavirinae; Betacoronavirus; Sarbecovirus; Severe acute respiratory syndrome-related coronavirus
Organism
vg  Viruses (Severe acute respiratory syndrome-related coronavirus)
SSDB
Motif
Pfam: bCoV_viroporin
Other DBs
NCBI-GeneID: 1489669
NCBI-ProteinID: YP_009825052
RS: NC_004718
Position
NC_004718:25268..26092
AA seq 274 aa
MDLFMRFFTLRSITAQPVKIDNASPASTVHATATIPLQASLPFGWLVIGVAFLAVFQSAT
KIIALNKRWQLALYKGFQFICNLLLLFVTIYSHLLLVAAGMEAQFLYLYALIYFLQCINA
CRIIMRCWLCWKCKSKNPLLYDANYFVCWHTHNYDYCIPYNSVTDTIVVTEGDGISTPKL
KEDYQIGGYSEDRHSGVKDYVVVHGYFTEVYYQLESTQITTDTGIENATFFIFNKLVKDP
PNVQIHTIDGSSGVANPAMDPIYDEPTTTTSVPL
NT seq 825 nt   +upstreamnt  +downstreamnt
atggatttgtttatgagattttttactcttagatcaattactgcacagccagtaaaaatt
gacaatgcttctcctgcaagtactgttcatgctacagcaacgataccgctacaagcctca
ctccctttcggatggcttgttattggcgttgcatttcttgctgtttttcagagcgctacc
aaaataattgcgctcaataaaagatggcagctagccctttataagggcttccagttcatt
tgcaatttactgctgctatttgttaccatctattcacatcttttgcttgtcgctgcaggt
atggaggcgcaatttttgtacctctatgccttgatatattttctacaatgcatcaacgca
tgtagaattattatgagatgttggctttgttggaagtgcaaatccaagaacccattactt
tatgatgccaactactttgtttgctggcacacacataactatgactactgtataccatat
aacagtgtcacagatacaattgtcgttactgaaggtgacggcatttcaacaccaaaactc
aaagaagactaccaaattggtggttattctgaggataggcactcaggtgttaaagactat
gtcgttgtacatggctatttcaccgaagtttactaccagcttgagtctacacaaattact
acagacactggtattgaaaatgctacattcttcatctttaacaagcttgttaaagaccca
ccgaatgtgcaaatacacacaatcgacggctcttcaggagttgctaatccagcaatggat
ccaatttatgatgagccgacgacgactactagcgtgcctttgtaa

DBGET integrated database retrieval system