KEGG   Viruses: 1489674
Entry
1489674           CDS       T40000                                 

Gene name
sars7a
Definition
(RefSeq) SARS coronavirus Tor2; Orf8
Taxonomy
TAX:227984 [GN:T40069]
  Lineage
Viruses; +ssRNA viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes; Nidovirales; Cornidovirineae; Coronaviridae; Orthocoronavirinae; Betacoronavirus; Sarbecovirus; Severe acute respiratory syndrome-related coronavirus
Organism
vg  Viruses (Severe acute respiratory syndrome-related coronavirus)
SSDB
Motif
Pfam: bCoV_NS7A bCoV_NS8
Other DBs
NCBI-GeneID: 1489674
NCBI-ProteinID: YP_009825057
RS: NC_004718
UniProt: P59635 Q19QW4
Position
NC_004718:27273..27641
AA seq 122 aa
MKIILFLTLIVFTSCELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLADNKFALTCTS
THFAFACADGTRHTYQLRARSVSPKLFIRQEEVQQELYSPLFLIVAALVFLILCFTIKRK
TE
NT seq 369 nt   +upstreamnt  +downstreamnt
atgaaaattattctcttcctgacattgattgtatttacatcttgcgagctatatcactat
caggagtgtgttagaggtacgactgtactactaaaagaaccttgcccatcaggaacatac
gagggcaattcaccatttcaccctcttgctgacaataaatttgcactaacttgcactagc
acacactttgcttttgcttgtgctgacggtactcgacatacctatcagctgcgtgcaaga
tcagtttcaccaaaacttttcatcagacaagaggaggttcaacaagagctctactcgcca
ctttttctcattgttgctgctctagtatttttaatactttgcttcaccattaagagaaag
acagaatga

DBGET integrated database retrieval system