KEGG   Viruses: 1502155Help
Entry
1502155           CDS       T40000                                 

Gene name
SINVgp3
Definition
(RefSeq) Sindbis virus; hypothetical protein
  KO
K19288  Alphavirus structral polyprotein
Taxonomy
TAX:11034
  Lineage
Viruses; ssRNA viruses; Togaviridae; Alphavirus
Taxonomy
Organism
vg  Viruses (Sindbis virus)
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha_E2_glycop Alpha_E1_glycop Peptidase_S3 Alpha_E3_glycop DUF3105
Motif
Other DBs
NCBI-GeneID: 1502155
NCBI-ProteinID: NP_062890
RS: NC_001547
UniProt: P03316
Structure
PDB: 

Position
NC_001547:7647..11384
AA seq 1245 aa AA seqDB search
MNRGFFNMLGRRPFPAPTAMWRPRRRRQAAPMPARNGLASQIQQLTTAVSALVIGQATRP
QPPRPRPPPRQKKQAPKQPPKPKKPKTQEKKKKQPAKPKPGKRQRMALKLEADRLFDVKN
EDGDVIGHALAMEGKVMKPLHVKGTIDHPVLSKLKFTKSSAYDMEFAQLPVNMRSEAFTY
TSEHPEGFYNWHHGAVQYSGGRFTIPRGVGGRGDSGRPIMDNSGRVVAIVLGGADEGTRT
ALSVVTWNSKGKTIKTTPEGTEEWSAAPLVTAMCLLGNVSFPCDRPPTCYTREPSRALDI
LEENVNHEAYDTLLNAILRCGSSGRSKRSVIDDFTLTSPYLGTCSYCHHTVPCFSPVKIE
QVWDEADDNTIRIQTSAQFGYDQSGAASANKYRYMSLKQDHTVKEGTMDDIKISTSGPCR
RLSYKGYFLLAKCPPGDSVTVSIVSSNSATSCTLARKIKPKFVGREKYDLPPVHGKKIPC
TVYDRLKETTAGYITMHRPRPHAYTSYLEESSGKVYAKPPSGKNITYECKCGDYKTGTVS
TRTEITGCTAIKQCVAYKSDQTKWVFNSPDLIRHDDHTAQGKLHLPFKLIPSTCMVPVAH
APNVIHGFKHISLQLDTDHLTLLTTRRLGANPEPTTEWIVGKTVRNFTVDRDGLEYIWGN
HEPVRVYAQESAPGDPHGWPHEIVQHYYHRHPVYTILAVASATVAMMIGVTVAVLCACKA
RRECLTPYALAPNAVIPTSLALLCCVRSANAETFTETMSYLWSNSQPFFWVQLCIPLAAF
IVLMRCCSCCLPFLVVAGAYLAKVDAYEHATTVPNVPQIPYKALVERAGYAPLNLEITVM
SSEVLPSTNQEYITCKFTTVVPSPKIKCCGSLECQPAAHADYTCKVFGGVYPFMWGGAQC
FCDSENSQMSEAYVELSADCASDHAQAIKVHTAAMKVGLRIVYGNTTSFLDVYVNGVTPG
TSKDLKVIAGPISASFTPFDHKVVIHRGLVYNYDFPEYGAMKPGAFGDIQATSLTSKDLI
ASTDIRLLKPSAKNVHVPYTQASSGFEMWKNNSGRPLQETAPFGCKIAVNPLRAVDCSYG
NIPISIDIPNAAFIRTSDAPLVSTVKCEVSECTYSADFGGMATLQYVSDREGQCPVHSHS
STATLQESTVHVLEKGAVTVHFSTASPQANFIVSLCGKKTTCNAECKPPADHIVSTPHKN
DQEFQAAISKTSWSWLFALFGGASSLLIIGLMIFACSMMLTSTRR
NT seq 3738 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaggattctttaacatgctcggccgccgccccttcccggcccccactgccatg
tggaggccgcggagaaggaggcaggcggccccgatgcctgcccgcaacgggctggcttct
caaatccagcaactgaccacagccgtcagtgccctagtcattggacaggcaactagacct
caacccccacgtccacgcccgccaccgcgccagaagaagcaggcgcccaagcaaccaccg
aagccgaagaaaccaaaaacgcaggagaagaagaagaagcaacctgcaaaacccaaaccc
ggaaagagacagcgcatggcacttaagttggaggccgacagattgttcgacgtcaagaac
gaggacggagatgtcatcgggcacgcactggccatggaaggaaaggtaatgaaacctctg
cacgtgaaaggaaccatcgaccaccctgtgctatcaaagctcaaatttaccaagtcgtca
gcatacgacatggagttcgcacagttgccagtcaacatgagaagtgaggcattcacctac
accagtgaacaccccgaaggattctataactggcaccacggagcggtgcagtatagtgga
ggtagatttaccatccctcgcggagtaggaggcagaggagacagcggtcgtccgatcatg
gataactccggtcgggttgtcgcgatagtcctcggtggcgctgatgaaggaacacgaact
gccctttcggtcgtcacctggaatagtaaagggaagacaattaagacgaccccggaaggg
acagaagagtggtccgcagcaccactggtcacggcaatgtgtttgctcggaaatgtgagc
ttcccatgcgaccgcccgcccacatgctatacccgcgaaccttccagagccctcgacatc
cttgaagagaacgtgaaccatgaggcctacgataccctgctcaatgccatattgcggtgc
ggatcgtctggcagaagcaaaagaagcgtcattgacgactttaccctgaccagcccctac
ttgggcacatgctcgtactgccaccatactgtaccgtgcttcagccctgttaagatcgag
caggtctgggacgaagcggacgataacaccatacgcatacagacttccgcccagtttgga
tacgaccaaagcggagcagcaagcgcaaacaagtaccgctacatgtcgcttaagcaggat
cacaccgttaaagaaggcaccatggatgacatcaagattagcacctcaggaccgtgtaga
aggcttagctacaaaggatactttctcctcgcaaaatgccctccaggggacagcgtaacg
gttagcatagtgagtagcaactcagcaacgtcatgtacactggcccgcaagataaaacca
aaattcgtgggacgggaaaaatatgatctacctcccgttcacggtaaaaaaattccttgc
acagtgtacgaccgtctgaaagaaacaactgcaggctacatcactatgcacaggccgaga
ccgcacgcttatacatcctacctggaagaatcatcagggaaagtttacgcaaagccgcca
tctgggaagaacattacgtatgagtgcaagtgcggcgactacaagaccggaaccgtttcg
acccgcaccgaaatcactggttgcaccgccatcaagcagtgcgtcgcctataagagcgac
caaacgaagtgggtcttcaactcaccggacttgatcagacatgacgaccacacggcccaa
gggaaattgcatttgcctttcaagttgatcccgagtacctgcatggtccctgttgcccac
gcgccgaatgtaatacatggctttaaacacatcagcctccaattagatacagaccacttg
acattgctcaccaccaggagactaggggcaaacccggaaccaaccactgaatggatcgtc
ggaaagacggtcagaaacttcaccgtcgaccgagatggcctggaatacatatggggaaat
catgagccagtgagggtctatgcccaagagtcagcaccaggagaccctcacggatggcca
cacgaaatagtacagcattactaccatcgccatcctgtgtacaccatcttagccgtcgca
tcagctaccgtggcgatgatgattggcgtaactgttgcagtgttatgtgcctgtaaagcg
cgccgtgagtgcctgacgccatacgccctggccccaaacgccgtaatcccaacttcgctg
gcactcttgtgctgcgttaggtcggccaatgctgaaacgttcaccgagaccatgagttac
ttgtggtcgaacagtcagccgttcttctgggtccagttgtgcatacctttggccgctttc
atcgttctaatgcgctgctgctcctgctgcctgccttttttagtggttgccggcgcctac
ctggcgaaggtagacgcctacgaacatgcgaccactgttccaaatgtgccacagataccg
tataaggcacttgttgaaagggcagggtatgccccgctcaatttggagatcactgtcatg
tcctcggaggttttgccttccaccaaccaagagtacattacctgcaaattcaccactgtg
gtcccctccccaaaaatcaaatgctgcggctccttggaatgtcagccggccgctcatgca
gactatacctgcaaggtcttcggaggggtctacccctttatgtggggaggagcgcaatgt
ttttgcgacagtgagaacagccagatgagtgaggcgtacgtcgaattgtcagcagattgc
gcgtctgaccacgcgcaggcgattaaggtgcacactgccgcgatgaaagtaggactgcgt
attgtgtacgggaacactaccagtttcctagatgtgtacgtgaacggagtcacaccagga
acgtctaaagacttgaaagtcatagctggaccaatttcagcatcgtttacgccattcgat
cataaggtcgttatccatcgcggcctggtgtacaactatgacttcccggaatatggagcg
atgaaaccaggagcgtttggagacattcaagctacctccttgactagcaaggatctcatc
gccagcacagacattaggctactcaagccttccgccaagaacgtgcatgtcccgtacacg
caggcctcatcaggatttgagatgtggaaaaacaactcaggccgcccactgcaggaaacc
gcacctttcgggtgtaagattgcagtaaatccgctccgagcggtggactgttcatacggg
aacattcccatttctattgacatcccgaacgctgcctttatcaggacatcagatgcacca
ctggtctcaacagtcaaatgtgaagtcagtgagtgcacttattcagcagacttcggcggg
atggccaccctgcagtatgtatccgaccgcgaaggtcaatgccccgtacattcgcattcg
agcacagcaactctccaagagtcgacagtacatgtcctggagaaaggagcggtgacagta
cactttagcaccgcgagtccacaggcgaactttatcgtatcgctgtgtgggaagaagaca
acatgcaatgcagaatgtaaaccaccagctgaccatatcgtgagcaccccgcacaaaaat
gaccaagaatttcaagccgccatctcaaaaacatcatggagttggctgtttgcccttttc
ggcggcgcctcgtcgctattaattataggacttatgatttttgcttgcagcatgatgctg
actagcacacgaagatga

DBGET integrated database retrieval system