KEGG   Viruses: 155908Help
Entry
155908            CDS       T40000                                 

Gene name
rev, HIV1gp6
Definition
(RefSeq) Human immunodeficiency virus 1; Rev
Taxonomy
TAX:11676 [GN:T40001]
  Lineage
Viruses; ssRNA-RT viruses; Ortervirales; Retroviridae; Orthoretrovirinae; Lentivirus
Taxonomy
Organism
vg  Viruses (Human immunodeficiency virus 1)
SSDB OrthologParalogGFIT
Motif
Pfam: REV
Motif
Other DBs
NCBI-GeneID: 155908
NCBI-ProteinID: NP_057854
RS: NC_001802
UniProt: P04618 Q77YF8
Position
NC_001802:join(5516..5591,7925..8199)
AA seq 116 aa AA seqDB search
MAGRSGDSDEELIRTVRLIKLLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERIL
GTYLGRSAEPVPLQLPPLERLTLDCNEDCGTSGTQGVGSPQILVESPTVLESGTKE
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaagaagcggagacagcgacgaagagctcatcagaacagtcagactcatcaag
cttctctatcaaagcaacccacctcccaaccccgaggggacccgacaggcccgaaggaat
agaagaagaaggtggagagagagacagagacagatccattcgattagtgaacggatcctt
ggcacttatctgggacgatctgcggagcctgtgcctcttcagctaccaccgcttgagaga
cttactcttgattgtaacgaggattgtggaacttctgggacgcagggggtgggaagccct
caaatattggtggaatctcctacagtattggagtcaggaactaaagaatag

DBGET integrated database retrieval system