KEGG   Viruses: 1724714
Entry
1724714           CDS       T40000                                 

Gene name
HIV2gp3
Definition
(RefSeq) Human immunodeficiency virus 2; vpx protein
Taxonomy
TAX:11709 [GN:T40002]
  Lineage
Viruses; ssRNA-RT viruses; Riboviria; Pararnavirae; Artverviricota; Revtraviricetes; Ortervirales; Retroviridae; Orthoretrovirinae; Lentivirus
Organism
vg  Viruses (Human immunodeficiency virus 2)
Motif
Pfam: VPR
Other DBs
NCBI-GeneID: 1724714
NCBI-ProteinID: NP_056840
RS: NC_001722
UniProt: P18099 A0A7D6GW92
Position
NC_001722:5898..6239
AA seq 113 aa
MTDPRERVPPGNSGEETIGEAFEWLERTIEALNREAVNHLPRELIFQVWQRSWRYWHDEQ
GMSASYTKYRYLCLMQKAIFTHFKRGCTCWGEDMGREGLEDQGPPPPPPPGLV
NT seq 342 nt   +upstreamnt  +downstreamnt
atgacagaccccagagaaagggtaccgccaggaaacagtggagaagagaccattggagag
gccttcgagtggctagagaggaccatagaagccttaaacagggaggcagtgaaccatctg
ccccgagagctcattttccaggtgtggcaaaggtcctggagatattggcatgatgaacaa
gggatgtcagcaagctacacaaagtatagatatttgtgcctaatgcaaaaagctatattt
acacatttcaagagagggtgcacttgctggggggaggacatgggccgggaaggattggaa
gaccaaggacctccccctcctccccctccaggtctagtctaa

DBGET integrated database retrieval system