KEGG   Viruses: 1733198Help
Entry
1733198           CDS       T40000                                 

Gene name
IIV6gp193
Definition
(RefSeq) Invertebrate iridescent virus 6; 197R
Taxonomy
TAX:176652
  Lineage
Viruses; dsDNA viruses, no RNA stage; Iridoviridae; Betairidovirinae; Iridovirus
Taxonomy
Organism
vg  Viruses (Invertebrate iridescent virus 6)
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc CDKN3 Y_phosphatase3 Y_phosphatase DUF1768
Motif
Other DBs
NCBI-GeneID: 1733198
NCBI-ProteinID: NP_149660
RS: NC_003038
UniProt: Q91FX3
Position
NC_003038:84586..85386
AA seq 266 aa AA seqDB search
MDELMGKTCSYFYPRPTLGSLSDKKALFGGYPTQEQVYLLESIGVEWFVDLTLGNEKRTT
PYIIQNKEKYITFPIMDQRVPENIIEFVKFINKLVNIISGLTDCEKLYIHCKGGHGRSGL
IAATLLCVMDEISPEKAIKETTLSHPQTKAQCNFLHYLFGSQNINNDSLLSPYSHHQVII
VCGKTETVFKSASDAVYYLLHNSSGKSDYFIRCVEFVLDNKFQQHPSCKQQLLQTGFRQL
QCRLGQNCIGTICIKLRNKYYNNLEV
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggatgaattaatggggaaaacgtgttcgtatttttatcctagaccaactttaggatcc
ttatctgataaaaaagcattgtttggaggttatccaacacaagagcaggtgtatttatta
gaaagtataggtgttgaatggtttgtagatttgactttaggaaatgaaaaaagaactaca
ccgtacataattcaaaataaggaaaaatacatcacgtttcctataatggatcaaagagtt
ccagagaacataatcgaatttgtcaaatttataaacaaactggttaatataattagtgga
ttaacagattgtgaaaaattatacatccattgtaaaggtggtcacggacgtagtggttta
atagctgcaactcttctttgtgttatggatgaaataagtccagaaaaagctataaaagaa
accacactttctcatcctcaaaccaaagctcaatgcaattttttgcattatctttttgga
tcccaaaatataaataacgattctttactttctccatattctcatcatcaagttataatt
gtttgtggtaaaaccgaaacagtatttaaatcagcatccgatgctgtatattatttattg
cataattcttctggcaaatctgattattttatacgttgcgtagaatttgttttggataat
aaatttcaacaacatccttcttgcaaacaacaattattacaaaccggttttagacaactt
caatgccgcttaggacaaaattgtattggaactatttgtattaaacttcgaaataaatat
tataataatttagaagtttaa

DBGET integrated database retrieval system