KEGG   Viruses: 20194312
Entry
20194312          CDS       T40000                                 

Gene name
ORF2, KW74_gp02
Definition
(RefSeq) Equid alphaherpesvirus 3; membrane protein V1
Taxonomy
TAX:80341
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Alphaherpesvirinae; Varicellovirus
Organism
vg  Viruses (Equid alphaherpesvirus 3)
SSDB
Motif
Pfam: DUF5435
Other DBs
NCBI-GeneID: 20194312
NCBI-ProteinID: YP_009054905
RS: NC_024771
UniProt: A0A077B7H1
Position
NC_024771:complement(808..1500)
AA seq 230 aa
MARRPGRCAARTSPPKPLPPEPSLSAGAVRRSGLKASDLGASNARPRPQSQRPLQRLLAV
PAIGGMAKFFRKKRGGARSRSVWYEGGTAFPPSAWKGPARTSPYGYESDSDADEASRLRQ
GDGDRSRLASGAAGVRRELGVEAGSPAVLPLNGSRRRDPTPADVYLDGFPTLREQEELQL
APRPVQKSGGAGACCQRLVIANVVILLFQVLVLTGTIFYSLHHGHCNGKQ
NT seq 693 nt   +upstreamnt  +downstreamnt
atggcgcgccgcccgggccggtgtgccgctcgcacctctcctcccaaacccctcccaccc
gagcccagtttaagcgcgggagccgtgcggcggtcgggcttaaaagcttctgaccttggt
gcgagcaacgctcgcccgcggccccagagccagcgcccgctacagcgactcttggcggtt
ccggcaattggaggaatggccaagttcttcagaaagaagcgcgggggtgcgaggtcgcgg
agcgtgtggtacgagggcggaacggccttccccccgtcggcctggaagggccccgccaga
accagcccctacgggtacgagagcgactcggacgcggacgaggcatcgcgcctgcggcag
ggcgacggcgatcgctcgagactggcctcgggggcagcgggagtgcgccgcgagctgggc
gtggaggccgggagccccgccgtgctccccctaaacggatccaggaggcgtgaccccacg
ccggccgacgtgtacctggacggctttcccacgctgcgtgagcaggaggagctgcaactc
gccccccgccccgtccaaaagagcggcggggcgggggcatgctgccagcgcctggtcatc
gccaatgttgttatcttgttgtttcaagtgctcgtgctgacgggcacgatcttttacagc
cttcaccacggacactgtaacggaaagcaataa

DBGET integrated database retrieval system