KEGG   Viruses: 22647530
Entry
22647530          CDS       T40000                                 

Gene name
SB87_gp130
Definition
(RefSeq) Parapoxvirus red deer/HL953; putative vascular endothelial growth factor-like protein
  KO
K22612  Poxvirus vascular endothelial growth factor A homolog
Taxonomy
  Lineage
Viruses; dsDNA viruses; Varidnaviria; Bamfordvirae; Nucleocytoviricota; Pokkesviricetes; Chitovirales; Poxviridae; Chordopoxvirinae; Parapoxvirus; Parapoxvirus of red deer in New Zealand
Organism
vg  Viruses (Parapoxvirus of red deer in New Zealand)
SSDB
Motif
Pfam: PDGF Metallothio_2
Other DBs
NCBI-GeneID: 22647530
NCBI-ProteinID: YP_009112871
RS: NC_025963
UniProt: A0A0A7MAD4
Position
NC_025963:139142..139588
AA seq 148 aa
MRLLIQCSVVLILCLIQIHWIYASSGGSSNSGGSLADWMQTSDKSKCMPRDTVVYIGNEY
PGSVGERYNPQCVTVKRCGGCCGGDNKVCTSTETANTTVTVMVTAVSSSSGNGASSNFRD
ISMSEDKKCECREKFTTTPPPTTMPPRR
NT seq 447 nt   +upstreamnt  +downstreamnt
atgcgacttctaatacagtgcagcgtagtgcttatactgtgtctaatccaaatacattgg
atttatgcatcgtccggaggtagtagtaactcgggggggagtttagctgattggatgcag
acgtcggataaaagtaagtgcatgcccagagacaccgtggtatatattggaaatgaatat
ccaggaagtgtcggcgaacggtataatcctcaatgtgttaccgtcaagagatgcggaggc
tgttgcggcggagataataaagtatgcacctctacggaaacggcgaatacgacggtaacg
gttatggttacggcagtgtcgtctagttcaggaaacggcgcgtccagcaacttcagagat
ataagcatgagcgaagacaagaaatgcgagtgccgggaaaagtttaccaccacaccaccc
cccaccactatgcctccaagacgttag

DBGET integrated database retrieval system