KEGG   Viruses: 23104221
Entry
23104221          CDS       T40000                                 

Gene name
PB1-F2, TS66_s2gp2
Definition
(RefSeq) Influenza A virus (A/Shanghai/02/2013(H7N9)); PB1-F2 protein
  KO
K19397  Influenza A virus protein PB1-F2
Taxonomy
TAX:1332244 [GN:T40350]
  Lineage
Viruses; -ssRNA viruses; Riboviria; Orthornavirae; Negarnaviricota; Polyploviricotina; Insthoviricetes; Articulavirales; Orthomyxoviridae; Alphainfluenzavirus; Influenza A virus; H7N9 subtype
Organism
vg  Viruses (Influenza A virus)
SSDB
Motif
Pfam: PB1-F2 DUF2358
Other DBs
NCBI-GeneID: 23104221
NCBI-ProteinID: YP_009118472
RS: NC_026423
UniProt: R4NFR1
Position
NC_026423:95..367
AA seq 90 aa
MEQEQDTPWTQSTEHINTQKKESGQRTQRLEHPNSIQLMDHYLRTTSRVGMHKRIVYWKQ
WLSLKNLTQGSLKTRVSKRWKLFSKQEWIN
NT seq 273 nt   +upstreamnt  +downstreamnt
atggaacaggaacaggatacaccatggacacagtcaacagaacacataaatactcagaaa
aaggaaagtggacaacgaacacagagactggagcaccccaactcaatccaattgatggac
cattacctgaggacaacgagccgagtgggtatgcacaaacggattgtgtattggaagcaa
tggctttccttgaagaatctcacccagggatctttgaaaactcgtgtctcgaaacgatgg
aaattgttcagcaaacaagagtggataaactga

DBGET integrated database retrieval system