KEGG   Viruses: 23104227Help
Entry
23104227          CDS       T40000                                 

Gene name
HA, TS66_s4gp1
Definition
(RefSeq) Influenza A virus (A/Shanghai/02/2013(H7N9)); hemagglutinin
Taxonomy
TAX:1332244 [GN:T40350]
  Lineage
Viruses; ssRNA viruses; Negarnaviricota; Polyploviricotina; Insthoviricetes; Articulavirales; Orthomyxoviridae; Alphainfluenzavirus; Influenza A virus; H7N9 subtype
Taxonomy
Organism
vg  Viruses (Influenza A virus)
SSDB OrthologParalogGFIT
Motif
Pfam: Hemagglutinin Peptidase_M32 TelA
Motif
Other DBs
NCBI-GeneID: 23104227
NCBI-ProteinID: YP_009118475
RS: NC_026425
UniProt: R4NN21
Structure
PDB: 

Position
NC_026425:1..1683
AA seq 560 aa AA seqDB search
MNTQILVFALIAIIPTNADKICLGHHAVSNGTKVNTLTERGVEVVNATETVERTNIPRIC
SKGKRTVDLGQCGLLGTITGPPQCDQFLEFSADLIIERREGSDVCYPGKFVNEEALRQIL
RESGGIDKEAMGFTYSGIRTNGATSACRRSGSSFYAEMKWLLSNTDNAAFPQMTKSYKNT
RKSPALIVWGIHHSVSTAEQTKLYGSGNKLVTVGSSNYQQSFVPSPGARPQVNGLSGRID
FHWLMLNPNDTVTFSFNGAFIAPDRASFLRGKSMGIQSGVQVDANCEGDCYHSGGTIISN
LPFQNIDSRAVGKCPRYVKQRSLLLATGMKNVPEIPKGRGLFGAIAGFIENGWEGLIDGW
YGFRHQNAQGEGTAADYKSTQSAIDQITGKLNRLIEKTNQQFELIDNEFNEVEKQIGNVI
NWTRDSITEVWSYNAELLVAMENQHTIDLADSEMDKLYERVKRQLRENAEEDGTGCFEIF
HKCDDDCMASIRNNTYDHSKYREEAMQNRIQIDPVKLSSGYKDVILWFSFGASCFILLAI
VMGLVFICVKNGNMRCTICI
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgaacactcaaatcctggtattcgctctgattgcgatcattccaacaaatgcagacaaa
atctgcctcggacatcatgccgtgtcaaacggaaccaaagtaaacacattaactgaaaga
ggagtggaagtcgtcaatgcaactgaaacagtggaacgaacaaacatccccaggatctgc
tcaaaagggaaaaggacagttgacctcggtcaatgtggactcctggggacaatcactgga
ccacctcaatgtgaccaattcctagaattttcagccgatttaattattgagaggcgagaa
ggaagtgatgtctgttatcctgggaaattcgtgaatgaagaagctctgaggcaaattctc
agagaatcaggcggaattgacaaggaagcaatgggattcacatacagtggaataagaact
aatggagcaaccagtgcatgtaggagatcaggatcttcattctatgcagaaatgaaatgg
ctcctgtcaaacacagataatgctgcattcccgcagatgactaagtcatataaaaataca
agaaaaagcccagctctaatagtatgggggatccatcattccgtatcaactgcagagcaa
accaagctatatgggagtggaaacaaactggtgacagttgggagttctaattatcaacaa
tcttttgtaccgagtccaggagcgagaccacaagttaatggtctatctggaagaattgac
tttcattggctaatgctaaatcccaatgatacagtcactttcagtttcaatggggctttc
atagctccagaccgtgcaagcttcctgagaggaaaatctatgggaatccagagtggagta
caggttgatgccaattgtgaaggggactgctatcatagtggagggacaataataagtaac
ttgccatttcagaacatagatagcagggcagttggaaaatgtccgagatatgttaagcaa
aggagtctgctgctagcaacagggatgaagaatgttcctgagattccaaaaggaagaggc
ctatttggtgctatagcgggtttcattgaaaatggatgggaaggcctaattgatggttgg
tatggtttcagacaccagaatgcacagggagagggaactgctgcagattacaaaagcact
caatcggcaattgatcaaataacaggaaaattaaaccggcttatagaaaaaaccaaccaa
caatttgagttgatagacaatgaattcaatgaggtagagaagcaaatcggtaatgtgata
aattggaccagagattctataacagaagtgtggtcatacaatgctgaactcttggtagca
atggagaaccagcatacaattgatctggctgattcagaaatggacaaactgtacgaacga
gtgaaaagacagctgagagagaatgctgaagaagatggcactggttgctttgaaatattt
cacaagtgtgatgatgactgtatggccagtattagaaataacacctatgatcacagcaaa
tacagggaagaggcaatgcaaaatagaatacagattgacccagtcaaactaagcagcggc
tacaaagatgtgatactttggtttagcttcggggcatcatgtttcatacttctagccatt
gtaatgggccttgtcttcatatgtgtaaagaatggaaacatgcggtgcactatttgtata
taa

DBGET integrated database retrieval system