KEGG   Viruses: 24271467
Entry
24271467          CDS       T40000                                 
Symbol
UL23, HHV1gp00p53
Name
(RefSeq) Human alphaherpesvirus 1; involved in nucleotide metabolism
Virus
10298  Human alphaherpesvirus 1
SSDB
Motif
Pfam: Herpes_TK AAA_28 AAA_18
Other DBs
NCBI-GeneID: 24271467
NCBI-ProteinID: YP_009137097
RS: NC_001806
UniProt: P0DTH5
Structure
Position
NC_001806:complement(46673..47803)
AA seq 376 aa
MASYPCHQHASAFDQAARSRGHNNRRTALRPRRQQKATEVRLEQKMPTLLRVYIDGPHGM
GKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGEISAGDAAVV
MTSAQITMGMPYAVTDAVLAPHIGGEAGSSHAPPPALTLIFDRHPIAALLCYPAARYLMG
SMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAAIRRVYG
LLANTVRYLQGGGSWREDWGQLSGAAVPPQGAEPQSNAGPRPHIGDTLFTLFRAPELLAP
NGDLYNVFAWALDVLAKRLRPMHVFILDYDQSPAGCRDALLQLTSGMVQTHVTTPGSIPT
ICDLARTFAREMGEAN
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggcttcgtacccctgccatcaacacgcgtctgcgttcgaccaggctgcgcgttctcgc
ggccataacaaccgacgtacggcgttgcgccctcgccggcagcaaaaagccacggaagtc
cgcctggagcagaaaatgcccacgctactgcgggtttatatagacggtccccacgggatg
gggaaaaccaccaccacgcaactgctggtggccctgggttcgcgcgacgatatcgtctac
gtacccgagccgatgacttactggcgggtgttgggggcttccgagacaatcgcgaacatc
tacaccacacaacaccgcctcgaccagggtgagatatcggccggggacgcggcggtggta
atgacaagcgcccagataacaatgggcatgccttatgccgtgaccgacgccgttctggct
cctcatatcgggggggaggctgggagctcacatgccccgcccccggccctcaccctcatc
ttcgaccgccatcccatcgccgccctcctgtgctacccggccgcgcgataccttatgggc
agcatgaccccccaggccgtgctggcgttcgtggccctcatcccgccgaccttgcccggc
acaaacatcgtgttgggggcccttccggaggacagacacatcgaccgcctggccaaacgc
cagcgccccggcgagcggcttgacctggctatgctggccgcgattcgccgcgtttatggg
ctgcttgccaatacggtgcggtatctgcagggcggcgggtcgtggcgggaggattgggga
cagctttcgggggcggccgtgccgccccagggtgccgagccccagagcaacgcgggccca
cgaccccatatcggggacacgttatttaccctgtttcgggcccccgagttgctggccccc
aacggcgacctgtataacgtgtttgcctgggctttggacgtcttggccaaacgcctccgt
cccatgcacgtctttatcctggattacgaccaatcgcccgccggctgccgggacgccctg
ctgcaacttacctccgggatggtccagacccacgtcaccaccccaggctccataccgacg
atctgcgacctggcgcgcacgtttgcccgggagatgggggaggctaactga

DBGET integrated database retrieval system