KEGG   Viruses: 24271467Help
Entry
24271467          CDS       T40000                                 

Gene name
UL23, HHV1gp00p53
Definition
(RefSeq) Human alphaherpesvirus 1; involved in nucleotide metabolism
Taxonomy
TAX:10298 [GN:T40073]
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Alphaherpesvirinae; Simplexvirus
Taxonomy
Organism
vg  Viruses (Human alphaherpesvirus 1)
SSDB OrthologParalogGFIT
Motif
Pfam: Herpes_TK AAA_28 AAA_18
Motif
Other DBs
NCBI-GeneID: 24271467
NCBI-ProteinID: YP_009137097
RS: NC_001806
UniProt: P03176 G8HBD6
Structure
PDB: 

Position
NC_001806:complement(46673..47803)
AA seq 376 aa AA seqDB search
MASYPCHQHASAFDQAARSRGHNNRRTALRPRRQQKATEVRLEQKMPTLLRVYIDGPHGM
GKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGEISAGDAAVV
MTSAQITMGMPYAVTDAVLAPHIGGEAGSSHAPPPALTLIFDRHPIAALLCYPAARYLMG
SMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAAIRRVYG
LLANTVRYLQGGGSWREDWGQLSGAAVPPQGAEPQSNAGPRPHIGDTLFTLFRAPELLAP
NGDLYNVFAWALDVLAKRLRPMHVFILDYDQSPAGCRDALLQLTSGMVQTHVTTPGSIPT
ICDLARTFAREMGEAN
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgtacccctgccatcaacacgcgtctgcgttcgaccaggctgcgcgttctcgc
ggccataacaaccgacgtacggcgttgcgccctcgccggcagcaaaaagccacggaagtc
cgcctggagcagaaaatgcccacgctactgcgggtttatatagacggtccccacgggatg
gggaaaaccaccaccacgcaactgctggtggccctgggttcgcgcgacgatatcgtctac
gtacccgagccgatgacttactggcgggtgttgggggcttccgagacaatcgcgaacatc
tacaccacacaacaccgcctcgaccagggtgagatatcggccggggacgcggcggtggta
atgacaagcgcccagataacaatgggcatgccttatgccgtgaccgacgccgttctggct
cctcatatcgggggggaggctgggagctcacatgccccgcccccggccctcaccctcatc
ttcgaccgccatcccatcgccgccctcctgtgctacccggccgcgcgataccttatgggc
agcatgaccccccaggccgtgctggcgttcgtggccctcatcccgccgaccttgcccggc
acaaacatcgtgttgggggcccttccggaggacagacacatcgaccgcctggccaaacgc
cagcgccccggcgagcggcttgacctggctatgctggccgcgattcgccgcgtttatggg
ctgcttgccaatacggtgcggtatctgcagggcggcgggtcgtggcgggaggattgggga
cagctttcgggggcggccgtgccgccccagggtgccgagccccagagcaacgcgggccca
cgaccccatatcggggacacgttatttaccctgtttcgggcccccgagttgctggccccc
aacggcgacctgtataacgtgtttgcctgggctttggacgtcttggccaaacgcctccgt
cccatgcacgtctttatcctggattacgaccaatcgcccgccggctgccgggacgccctg
ctgcaacttacctccgggatggtccagacccacgtcaccaccccaggctccataccgacg
atctgcgacctggcgcgcacgtttgcccgggagatgggggaggctaactga

DBGET integrated database retrieval system