KEGG   Viruses: 24271473Help
Entry
24271473          CDS       T40000                                 

Gene name
UL48, HHV1gp00p27
Definition
(RefSeq) Human alphaherpesvirus 1; transactivating tegument protein VP16
  KO
K19444  Simplexvirus tegument protein VP16
Taxonomy
TAX:10298 [GN:T40073]
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Alphaherpesvirinae; Simplexvirus
Taxonomy
Organism
vg  Viruses (Human alphaherpesvirus 1)
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha_TIF HSV_VP16_C
Motif
Other DBs
NCBI-GeneID: 24271473
NCBI-ProteinID: YP_009137123
RS: NC_001806
UniProt: P06492 G8HBG2
Structure
PDB: 

Position
NC_001806:complement(103608..105080)
AA seq 490 aa AA seqDB search
MDLLVDELFADMNADGASPPPPRPAGGPKNTPAAPPLYATGRLSQAQLMPSPPMPVPPAA
LFNRLLDDLGFSAGPALCTMLDTWNEDLFSALPTNADLYRECKFLSTLPSDVVEWGDAYV
PERTQIDIRAHGDVAFPTLPATRDGLGLYYEALSRFFHAELRAREESYRTVLANFCSALY
RYLRASVRQLHRQAHMRGRDRDLGEMLRATIADRYYRETARLARVLFLHLYLFLTREILW
AAYAEQMMRPDLFDCLCCDLESWRQLAGLFQPFMFVNGALTVRGVPIEARRLRELNHIRE
HLNLPLVRSAATEEPGAPLTTPPTLHGNQARASGYFMVLIRAKLDSYSSFTTSPSEAVMR
EHAYSRARTKNNYGSTIEGLLDLPDDDAPEEAGLAAPRLSFLPAGHTRRLSTAPPTDVSL
GDELHLDGEDVAMAHADALDDFDLDMLGDGDSPGPGFTPHDSAPYGALDMADFEFEQMFT
DALGIDEYGG
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggacctcttggtcgacgagctgtttgccgacatgaacgcggacggcgcttcgccaccg
cccccccgcccggccgggggtcccaaaaacaccccggcggcccccccgctgtacgcaacg
gggcgcctgagccaggcccagctcatgccctccccacccatgcccgtcccccccgccgcc
ctctttaaccgtctcctcgacgacttgggctttagcgcgggccccgcgctatgtaccatg
ctcgatacctggaacgaggatctgttttcggcgctaccgaccaacgccgacctgtaccgg
gagtgtaaattcctatcaacgctgcccagcgatgtggtggaatggggggacgcgtacgtc
cccgaacgcacccaaatcgacattcgcgcccacggcgacgtggccttccctacgcttccg
gccacccgcgacggcctcgggctctactacgaagcgctctctcgtttcttccacgccgag
ctacgggcgcgggaggagagctatcgaaccgtgttggccaacttctgctcggccctgtac
cggtacctgcgcgccagcgtccggcagctgcaccgccaggcgcacatgcgcggacgcgat
cgcgacctgggagaaatgctgcgcgccacgatcgcggacaggtactaccgagagaccgct
cgtctggcgcgtgttttgtttttgcatttgtatctatttttgacccgcgagatcctatgg
gccgcgtacgccgagcagatgatgcggcccgacctgtttgactgcctctgttgcgacctg
gagagctggcgtcagttggcgggtctgttccagcccttcatgttcgtcaacggagcgctc
accgtccggggagtgccaatcgaggcccgccggctgcgggagctaaaccacattcgcgag
caccttaacctcccgctggtgcgcagcgcggctacggaggagccaggggcgccgttgacg
acccctcccaccctgcatggcaaccaggcccgcgcctctgggtactttatggtgttgatt
cgggcgaagttggactcgtattccagcttcacgacctcgccctccgaggcggtcatgcgg
gaacacgcgtacagccgcgcgcgtacgaaaaacaattacgggtctaccatcgagggcctg
ctcgatctcccggacgacgacgcccccgaagaggcggggctggcggctccgcgcctgtcc
tttctccccgcgggacacacgcgcagactgtcgacggcccccccgaccgatgtcagcctg
ggggacgagctccacttagacggcgaggacgtggcgatggcgcatgccgacgcgctagac
gatttcgatctggacatgttgggggacggggattccccggggccgggatttaccccccac
gactccgccccctacggcgctctggatatggccgacttcgagtttgagcagatgtttacc
gatgcccttggaattgacgagtacggtgggtag

DBGET integrated database retrieval system