KEGG   Viruses: 2652998Help
Entry
2652998           CDS       T40000                                 

Gene name
L3, HAdVC_gp08
Definition
(RefSeq) Human mastadenovirus C; hexon
  KO
K21076  pre-protein VI
Taxonomy
TAX:129951 [GN:T40338]
  Lineage
Viruses; dsDNA viruses; Adenoviridae; Mastadenovirus
Taxonomy
Organism
vg  Viruses (Human mastadenovirus C)
SSDB OrthologParalogGFIT
Motif
Pfam: Adeno_hexon Adeno_hexon_C Pox_Ag35 PAC1
Motif
Other DBs
NCBI-GeneID: 2652998
NCBI-ProteinID: NP_040525
RS: NC_001405
UniProt: P03277 J9Z2Q0
Structure
PDB: 

Position
NC_001405:18838..21744
AA seq 968 aa AA seqDB search
MATPSMMPQWSYMHISGQDASEYLSPGLVQFARATETYFSLNNKFRNPTVAPTHDVTTDR
SQRLTLRFIPVDREDTAYSYKARFTLAVGDNRVLDMASTYFDIRGVLDRGPTFKPYSGTA
YNALAPKGAPNSCEWEQTEDSGRAVAEDEEEEDEDEEEEEEEQNARDQATKKTHVYAQAP
LSGETITKSGLQIGSDNAETQAKPVYADPSYQPEPQIGESQWNEADANAAGGRVLKKTTP
MKPCYGSYARPTNPFGGQSVLVPDEKGVPLPKVDLQFFSNTTSLNDRQGNATKPKVVLYS
EDVNMETPDTHLSYKPGKGDENSKAMLGQQSMPNRPNYIAFRDNFIGLMYYNSTGNMGVL
AGQASQLNAVVDLQDRNTELSYQLLLDSIGDRTRYFSMWNQAVDSYDPDVRIIENHGTED
ELPNYCFPLGGIGVTDTYQAIKANGNGSGDNGDTTWTKDETFATRNEIGVGNNFAMEINL
NANLWRNFLYSNIALYLPDKLKYNPTNVEISDNPNTYDYMNKRVVAPGLVDCYINLGARW
SLDYMDNVNPFNHHRNAGLRYRSMLLGNGRYVPFHIQVPQKFFAIKNLLLLPGSYTYEWN
FRKDVNMVLQSSLGNDLRVDGASIKFDSICLYATFFPMAHNTASTLEAMLRNDTNDQSFN
DYLSAANMLYPIPANATNVPISIPSRNWAAFRGWAFTRLKTKETPSLGSGYDPYYTYSGS
IPYLDGTFYLNHTFKKVAITFDSSVSWPGNDRLLTPNEFEIKRSVDGEGYNVAQCNMTKD
WFLVQMLANYNIGYQGFYIPESYKDRMYSFFRNFQPMSRQVVDDTKYKEYQQVGILHQHN
NSGFVGYLAPTMREGQAYPANVPYPLIGKTAVDSITQKKFLCDRTLWRIPFSSNFMSMGA
LTDLGQNLLYANSAHALDMTFEVDPMDEPTLLYVLFEVFDVVRVHQPHRGVIETVYLRTP
FSAGNATT
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
atggctaccccttcgatgatgccgcagtggtcttacatgcacatctcgggccaggacgcc
tcggagtacctgagccccgggctggtgcagtttgcccgcgccaccgagacgtacttcagc
ctgaataacaagtttagaaaccccacggtggcacctacgcacgacgtaaccacagaccgg
tcccagcgtttgacgctgcggttcatccctgtggaccgcgaggataccgcgtactcgtac
aaagcgcggttcaccctggctgtgggtgacaaccgtgtgcttgatatggcttccacgtac
tttgacatccgcggcgtgctggacagggggcctacttttaagccctactccggcactgcc
tacaacgctctagctcccaagggcgctcctaactcctgtgagtgggaacaaaccgaagat
agcggccgggcagttgccgaggatgaagaagaggaagatgaagatgaagaagaggaagaa
gaagagcaaaacgctcgagatcaggctactaagaaaacacatgtctatgcccaggctcct
ttgtctggagaaacaattacaaaaagcgggctacaaataggatcagacaatgcagaaaca
caagctaaacctgtatacgcagatccttcctatcaaccagaacctcaaattggcgaatct
cagtggaacgaagctgatgctaatgcggcaggagggagagtgcttaaaaaaacaactccc
atgaaaccatgctatggatcttatgccaggcctacaaatccttttggtggtcaatccgtt
ctggttccggatgaaaaaggggtgcctcttccaaaggttgacttgcaattcttctcaaat
actacctctttgaacgaccggcaaggcaatgctactaaaccaaaagtggttttgtacagt
gaagatgtaaatatggaaaccccagacacacatctgtcttacaaacctggaaaaggtgat
gaaaattctaaagctatgttgggtcaacaatctatgccaaacagacccaattacattgct
ttcagggacaattttattggcctaatgtattataacagcactggcaacatgggtgttctt
gctggtcaggcatcgcagctaaatgccgtggtagatttgcaagacagaaacacagagctg
tcctatcaactcttgcttgattccataggtgatagaaccagatatttttctatgtggaat
caggctgtagacagctatgatccagatgttagaatcattgaaaaccatggaactgaggat
gaattgccaaattattgttttcctcttgggggtattggggtaactgacacctatcaagct
attaaggctaatggcaatggctcaggcgataatggagatactacatggacaaaagatgaa
acttttgcaacacgtaatgaaataggagtgggtaacaactttgccatggaaattaaccta
aatgccaacctatggagaaatttcctttactccaatattgcgctgtacctgccagacaag
ctaaaatacaaccccaccaatgtggaaatatctgacaaccccaacacctacgactacatg
aacaagcgagtggtggctcccgggcttgtagactgctacattaaccttggggcgcgctgg
tctctggactacatggacaacgttaatccctttaaccaccaccgcaatgcgggcctccgt
tatcgctccatgttgttgggaaacggccgctacgtgccctttcacattcaggtgccccaa
aagttttttgccattaaaaacctcctcctcctgccaggctcatatacatatgaatggaac
ttcaggaaggatgttaacatggttctgcagagctctctgggaaacgatcttagagttgac
ggggctagcattaagtttgacagcatttgtctttacgccaccttcttccccatggcccac
aacacggcctccacgctggaagccatgctcagaaatgacaccaacgaccagtcctttaat
gactacctttccgccgccaacatgctataccccatacccgccaacgccaccaacgtgccc
atctccatcccatcgcgcaactgggcagcatttcgcggttgggccttcacacgcttgaag
acaaaggaaaccccttccctgggatcaggctacgacccttactacacctactctggctcc
ataccataccttgacggaaccttctatcttaatcacacctttaagaaggtggccattacc
tttgactcttctgttagctggccgggcaacgaccgcctgcttactcccaatgagtttgag
attaaacgctcagttgacggggagggctacaacgtagctcagtgcaacatgaccaaggac
tggttcctggtgcagatgttggccaactacaatattggctaccagggcttctacattcca
gaaagctacaaggaccgcatgtactcgttcttcagaaacttccagcccatgagccggcaa
gtggttgacgatactaaatacaaggagtatcagcaggttggaattcttcaccagcataac
aactcaggattcgtaggctacctcgctcccaccatgcgcgagggacaggcttaccccgcc
aacgtgccctacccactaataggcaaaaccgcggttgacagtattacccagaaaaagttt
ctttgcgatcgcaccctttggcgcatcccattctccagtaactttatgtccatgggcgca
ctcacagacctgggccaaaaccttctctacgccaactccgcccacgcgctagacatgact
tttgaggtggatcccatggacgagcccacccttctttatgttttgtttgaagtctttgac
gtggtccgtgtgcaccagccgcaccgcggcgtcatcgagaccgtgtacctgcgcacgccc
ttctcggccggcaacgccacaacataa

DBGET integrated database retrieval system