KEGG   Viruses: 2703361Help
Entry
2703361           CDS       T40000                                 

Gene name
UL39, HHV1gp00p36
Definition
(RefSeq) Human alphaherpesvirus 1; ribonucleotide reductase subunit 1
  KO
K19448  Simplexvirus ribonucleoside-diphosphate reductase large subunit [EC:1.17.4.1]
Taxonomy
TAX:10298 [GN:T40073]
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Alphaherpesvirinae; Simplexvirus
Taxonomy
Organism
vg  Viruses (Human alphaherpesvirus 1)
SSDB OrthologParalogGFIT
Motif
Pfam: Ribonuc_red_lgC Ribonuc_red_lgN
Motif
Other DBs
NCBI-GeneID: 2703361
NCBI-ProteinID: YP_009137114
RS: NC_001806
UniProt: P08543 G8HBF3
Position
NC_001806:86443..89856
AA seq 1137 aa AA seqDB search
MASRPAASSPVEARAPVGGQEAGGPSAATQGEAAGAPLAHGHHVYCQRVNGVMVLSDKTP
GSASYRISDSNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPAPFVAVTNIGAGSDGGTAV
VAFGGTPRRSAGTSTGTQTADVPTEALGGPPPPPRFTLGGGCCSCRDTRRRSAVFGGEGD
PVGPAEFVSDDRSSDSDSDDSEDTDSETLSHASSDVSGGATYDDALDSDSSSDDSLQIDG
PVCRPWSNDTAPLDVCPGTPGPGADAGGPSAVDPHAPTPEAGAGLAADPAVARDDAEGLS
DPRPRLGTGTAYPVPLELTPENAEAVARFLGDAVNREPALMLEYFCRCAREETKRVPPRT
FGSPPRLTEDDFGLLNYALVEMQRLCLDVPPVPPNAYMPYYLREYVTRLVNGFKPLVSRS
ARLYRILGVLVHLRIRTREASFEEWLRSKEVALDFGLTERLREHEAQLVILAQALDHYDC
LIHSTPHTLVERGLQSALKYEEFYLKRFGGHYMESVFQMYTRIAGFLACRATRGMRHIAL
GREGSWWEMFKFFFHRLYDHQIVPSTPAMLNLGTRNYYTSSCYLVNPQATTNKATLRAIT
SNVSAILARNGGIGLCVQAFNDSGPGTASVMPALKVLDSLVAAHNKESARPTGACVYLEP
WHTDVRAVLRMKGVLAGEEAQRCDNIFSALWMPDLFFKRLIRHLDGEKNVTWTLFDRDTS
MSLADFHGEEFEKLYQHLEVMGFGEQIPIQELAYGIVRSAATTGSPFVMFKDAVNRHYIY
DTQGAAIAGSNLCTEIVHPASKRSSGVCNLGSVNLARCVSRQTFDFGRLRDAVQACVLMV
NIMIDSTLQPTPQCTRGNDNLRSMGIGMQGLHTACLKLGLDLESAEFQDLNKHIAEVMLL
SAMKTSNALCVRGARPFNHFKRSMYRAGRFHWERFPDARPRYEGEWEMLRQSMMKHGLRN
SQFVALMPTAASAQISDVSEGFAPLFTNLFSKVTRDGETLRPNTLLLKELERTFSGKRLL
EVMDSLDAKQWSVAQALPCLEPTHPLRRFKTAFDYDQKLLIDLCADRAPYVDHSQSMTLY
VTEKADGTLPASTLVRLLVHAYKRGLKTGMYYCKVRKATNSGVFGGDDNIVCMSCAL
NT seq 3414 nt NT seq  +upstreamnt  +downstreamnt
atggccagccgcccagccgcatcctctcccgtcgaagcgcgggccccggttgggggacag
gaggccggcggccccagcgcagccacccagggggaggccgccggggcccctctcgcccac
ggccaccacgtgtactgccagcgagtcaatggcgtgatggtgctttccgacaagacgccc
gggtccgcgtcctaccgcatcagcgatagcaactttgtccaatgtggttccaactgcacc
atgatcatcgacggagacgtggtgcgcgggcgcccccaggacccgggggccgcggcatcc
cccgctcccttcgttgcggtgacaaacatcggagccggcagcgacggcgggaccgccgtc
gtggcattcgggggaaccccacgtcgctcggcggggacgtctaccggtacccagacggcc
gacgtccccaccgaggcccttgggggcccccctcctcctccccgcttcaccctgggtggc
ggctgttgttcctgtcgcgacacacggcgccgctctgcggtattcgggggggagggggat
ccagtcggccccgcggagttcgtctcggacgaccggtcgtccgattccgactcggatgac
tcggaggacacggactcggagacgctgtcacacgcctcctcggacgtgtccggcggggcc
acgtacgacgacgcccttgactccgattcgtcatcggatgactccctgcagatagatggc
cccgtgtgtcgcccgtggagcaatgacaccgcgcccctggatgtttgccccgggaccccc
ggcccgggcgccgacgccggtggtccctcagcggtagacccacacgcgccgacgccagag
gccggcgctggtcttgcggccgatcccgccgtggcccgggacgacgcggaggggctttcg
gacccccggccacgtctgggaacgggcacggcctaccccgtccccctggaactcacgccc
gagaacgcggaggccgtggcgcgctttctgggagatgccgtgaaccgcgaacccgcgctc
atgctggagtacttttgccggtgcgcccgcgaggaaaccaagcgtgtcccccccaggaca
ttcggcagcccccctcgcctcacggaggacgactttgggcttctcaactacgcgctcgtg
gagatgcagcgcctgtgtctggacgttcctccggtcccgccgaacgcatacatgccctat
tatctcagggagtatgtgacgcggctggtcaacgggttcaagccgctggtgagccggtcc
gctcgcctttaccgcatcctgggggttctggtgcacctgcggatccggacccgggaggcc
tcctttgaggagtggctgcgatccaaggaagtggccctggattttggcctgacggaaagg
cttcgcgagcacgaagcccagctggtgatcctggcccaggctctggaccattacgactgt
ctgatccacagcacaccgcacacgctggtcgagcgggggctgcaatcggccctgaagtat
gaggagttttacctaaagcgttttggcgggcactacatggagtccgtcttccagatgtac
acccgcatcgccggctttttggcctgccgggccacgcgcggcatgcgccacatcgccctg
gggcgagaggggtcgtggtgggaaatgttcaagttctttttccaccgcctctacgaccac
cagatcgtaccgtcgacccccgccatgctgaacctggggacccgcaactactacacctcc
agctgctacctggtaaacccccaggccaccacaaacaaggcgaccctgcgggccatcacc
agcaacgtcagtgccatcctcgcccgcaacgggggcatcgggctatgcgtgcaggcgttt
aacgactccggccccgggaccgccagcgtcatgcccgccctcaaggtccttgactcgctg
gtggcggcgcacaacaaagagagcgcgcgtccgaccggcgcgtgcgtgtacctggagccg
tggcacaccgacgtgcgggccgtgctccggatgaagggggtcctcgccggcgaagaggcc
cagcgctgcgacaatatcttcagcgccctctggatgccagacctgtttttcaagcgcctg
attcgccacctggacggcgagaagaacgtcacatggaccctgttcgaccgggacaccagc
atgtcgctcgccgactttcacggggaggagttcgagaagctctaccagcacctcgaggtc
atggggttcggcgagcagatacccatccaggagctggcctatggcattgtgcgcagtgcg
gccacgaccgggagccccttcgtcatgttcaaagacgcggtgaaccgccactacatctac
gacacccagggggcggccatcgccggctccaacctctgcaccgagatcgtccatccggcc
tccaagcgatccagtggggtctgcaacctgggaagcgtgaatctggcccgatgcgtctcc
aggcagacgtttgactttgggcggctccgcgacgccgtgcaggcgtgcgtgctgatggtg
aacatcatgatcgacagcacgctacaacccacgccccagtgcacccgcggcaacgacaac
ctgcggtccatgggaatcggcatgcagggcctgcacacggcctgcctgaagctggggctg
gatctggagtctgccgaatttcaggacctgaacaaacacatcgccgaggtgatgctgctg
tcggcgatgaagaccagcaacgcgctgtgcgttcgcggggcccgtcccttcaaccacttt
aagcgcagcatgtatcgcgccggccgctttcactgggagcgctttccggacgcccggccg
cggtacgagggcgagtgggagatgctacgccagagcatgatgaaacacggcctgcgcaac
agccagtttgtcgcgctgatgcccaccgccgcctcggcgcagatctcggacgtcagcgag
ggctttgcccccctgttcaccaacctgttcagcaaggtgacccgggacggcgagacgctg
cgccccaacacgctcctgctaaaggaactggaacgcacgtttagcgggaagcgcctcctg
gaggtgatggacagtctcgacgccaagcagtggtccgtggcgcaggcgctcccgtgcctg
gagcccacccaccccctccggcgattcaagaccgcgtttgactacgaccagaagttgctg
atcgacctgtgtgcggaccgcgccccctacgtcgaccatagccaatccatgaccctgtat
gtcacggagaaggcggacgggaccctcccagcctccaccctggtccgccttctggtccac
gcatataagcgcggactaaaaacagggatgtactactgcaaggttcgcaaggcgaccaac
agcggggtctttggcggcgacgacaacattgtctgcatgagctgcgcgctgtga

DBGET integrated database retrieval system