KEGG   Viruses: 2703362Help
Entry
2703362           CDS       T40000                                 

Gene name
UL4, HHV1gp00p71
Definition
(RefSeq) Human alphaherpesvirus 1; nuclear protein UL4
Taxonomy
TAX:10298 [GN:T40073]
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Alphaherpesvirinae; Simplexvirus
Taxonomy
Organism
vg  Viruses (Human alphaherpesvirus 1)
SSDB OrthologParalogGFIT
Motif
Pfam: Herpes_UL4
Motif
Other DBs
NCBI-GeneID: 2703362
NCBI-ProteinID: YP_009137078
RS: NC_001806
UniProt: P10188 Q771P6
Position
NC_001806:complement(11824..12423)
AA seq 199 aa AA seqDB search
MSNPQTTIAYSLCHARASLTSALPDAAQVVHVFEYGTRAIMVRGRERQDRLPRGGVVIQH
TPIGLLVIIDCRAEFCAYRFIGRDSNQKLERGWDAHMYAYPFDSWVSSSRGESARSATAG
ILTVVWTADTIYITATIYGSPPEETPGAAHGVGAAPPPPTTACPGTAEFLQPTADLLVEV
LREIQLSPALEYADKLLGS
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatccacagacgaccatcgcgtatagcctatgccacgccagggcctcgctgacc
agcgcactgcccgacgccgcgcaggtggtgcatgtttttgagtacggcacccgcgcgatc
atggtacggggccgggagcgccaggaccgcctgccgcgcggaggcgttgttatccagcac
acccccattgggctgttggtgattatcgactgtcgcgccgaattttgtgcctaccgcttt
ataggccgggacagcaaccagaagctcgaacgcgggtgggacgcccatatgtacgcgtat
ccgttcgactcctgggtcagctcctcgcgcggcgaaagcgcccggagcgccacggccggc
attttgaccgtggtctggaccgcggacaccatttacatcactgcaaccatttacgggtcg
cccccagaggagacgccaggcgcggcacacggggtgggcgccgcgcctccacccccgaca
accgcctgccccgggacggccgagtttctccagcccaccgcggacctgctggtagaggtg
ctgcgggagattcaactgagccccgccctggaatacgcagacaaacttttggggtcctag

DBGET integrated database retrieval system