KEGG   Viruses: 2703423Help
Entry
2703423           CDS       T40000                                 

Gene name
UL52, HHV1gp00p22
Definition
(RefSeq) Human alphaherpesvirus 1; helicase-primase primase subunit
Taxonomy
TAX:10298 [GN:T40073]
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Alphaherpesvirinae; Simplexvirus
Taxonomy
Organism
vg  Viruses (Human alphaherpesvirus 1)
SSDB OrthologParalogGFIT
Motif
Pfam: Herpes_UL52
Motif
Other DBs
NCBI-GeneID: 2703423
NCBI-ProteinID: YP_009137128
RS: NC_001806
UniProt: P10236 G8HBG7
Position
NC_001806:109049..112225
AA seq 1058 aa AA seqDB search
MGQEDGNRGERRAAGTPVEVTALYATDGCVITSSIALLTNSLLGAEPVYIFSYDAYTHDG
RADGPTEQDRFEESRALYQASGGLNGDSFRVTFCLLGTEVGGTHQARGRTRPMFVCRFER
ADDVAALQDALAHGTPLQPDHIAATLDAEATFALHANMILALTVAINNASPRTGRDAAAA
QYDQGASLRSLVGRTSLGQRGLTTLYVHHEVRVLAAYRRAYYGSAQSPFWFLSKFGPDEK
SLVLTTRYYLLQAQRLGGAGATYDLQAIKDICATYAIPHAPRPDTVSAASLTSFAAITRF
CCTSQYARGAAAAGFPLYVERRIAADVRETSALEKFITHDRSCLRVSDREFITYIYLAHF
ECFSPPRLATHLRAVTTHDPNPAASTEQPSPLGREAVEQFFCHVRAQLNIGEYVKHNVTP
RETVLDGDTAKAYLRARTYAPGALTPAPAYCGAVDSATKMMGRLADAEKLLVPRGWPAFA
PASPGEDTAGGTPPPQTCGIVKRLLRLAATEQQGPTPPAIAALIRNAAVQTPLPVYRISM
VPTGQAFAALAWDDWARITRDARLAEAVVSAEAAAHPDHGALGRRLTDRIRAQGPVMPPG
GLDAGGQMYVNRNEIFNGALAITNIILDLDIALKEPVPFRRLHEALGHFRRGALAAVQLL
FPAARVDPDAYPCYFFKSACRPGPASVGSGSGLGNDDDGDWFPCYDDAGDEEWAEDPGAM
DTSHDPPDDEVAYFDLCHEVGPTAEPRETDSPVCSCTDKIGLRVCMPVPAPYVVHGSLTM
RGVARVIQQAVLLDRDFVEAIGSYVKNFLLIDTGVYAHGHSLRLPYFAKIAPDGPACGRL
LPVFVIPPACKDVPAFVAAHADPRRFHFHAPPTYLASPREIRVLHSLGGDYVSFFERKAS
RNALEHFGRRETLTEVLGRYNVQPDAGGTVEGFASELLGRIVACIETHFPEHAGEYQAVS
VRRAVSKDDWVLLQLVPVRGTLQQSLSCLRFKHGRASRATARTFVALSVGANNRLCVSLC
QQCFAAKCDSNRLHTLFTIDAGTPCSPSVPCSTSQPSS
NT seq 3177 nt NT seq  +upstreamnt  +downstreamnt
atggggcaggaagacgggaaccgcggggagaggcgggcggccgggactcccgtggaggtg
accgcgctttatgcgaccgacgggtgcgttattacctcttcgatcgccctcctcacaaac
tctctactgggggccgagccggtttatatattcagctacgacgcatacacgcacgatggc
cgtgccgacgggcccacggagcaagacaggttcgaagagagtcgggcgctctaccaagcg
tcgggcgggctaaatggcgactccttccgagtaaccttttgtttattggggacggaagtg
ggtgggacccaccaggcccgcgggcgaacccgacccatgttcgtctgtcgcttcgagcga
gcggacgacgtcgccgcgctacaggacgccctggcgcacgggaccccgctacaaccggac
cacatcgccgccaccctggacgcggaggccacgttcgcgctgcatgcgaacatgatcctg
gctctcaccgtggccatcaacaacgccagcccccgcaccggacgcgacgccgccgcggcg
cagtatgatcagggcgcgtccctacgctcgctcgtggggcgcacgtccctgggacaacgc
ggccttaccacgctatacgtccaccacgaggtgcgcgtgcttgccgcgtaccgcagggcg
tattatggaagcgcgcagagtcccttctggtttcttagcaaattcgggccggacgaaaaa
agcctggtgctcaccactcggtactacctgcttcaggcccagcgtctggggggcgcgggg
gccacgtacgacctgcaggccatcaaggacatctgcgccacctacgcgattccccacgcc
ccccgccccgacaccgtcagcgctgcgtccctgacctcgtttgccgccatcacgcggttc
tgttgcacgagccagtacgcccgcggggccgcggcggccgggtttccgctttacgtggag
cgccgtattgcggccgacgtccgcgagaccagtgcgctggagaagttcataacccacgat
cgcagttgcctgcgcgtgtccgaccgtgaattcattacgtacatctacctggcccatttt
gagtgtttcagccccccgcgcctagccacgcatcttcgggccgtgacgacccacgacccc
aaccccgcggccagcacggagcagccctcgcccctgggcagggaggccgtggaacaattt
ttttgtcacgtgcgcgcccaactgaatatcggggagtacgtcaaacacaacgtgaccccc
cgggagaccgtcctggatggcgatacggccaaggcctacctgcgcgctcgcacgtacgcg
cccggggccctgacgcccgcccccgcgtattgcggggccgtggactccgccaccaaaatg
atggggcgtttggcggacgccgaaaagctcctggtcccccgcgggtggcccgcgtttgcg
cccgccagtcccggggaggacacggcgggcggcacgccgcccccacagacctgcggaatt
gtcaagcgcctcctgagactggccgccacggaacagcagggccccacacccccggcgatc
gcggcgcttatccgtaatgcggcggtgcagactcccctgcccgtctaccggatatccatg
gtccccacgggacaggcatttgccgcgctggcctgggacgactgggcccgcataacgcgg
gacgctcgcctggccgaagcggtcgtgtccgccgaagcggcggcgcaccccgaccacggc
gcgctgggcaggcggctcacggatcgcatccgcgcccagggccccgtgatgccccctggc
ggcctggatgccggggggcagatgtacgtgaatcgcaacgagatattcaacggcgcgctg
gcaatcacaaacatcatcctggatctcgacatcgccctgaaggagcccgtcccctttcgc
cggctccacgaggccctgggccactttaggcgcggggctctggctgcggttcagctcctg
tttcccgcggcccgcgtggaccccgacgcatatccctgttattttttcaaaagcgcatgt
cggcccggcccggcgtccgtgggttccggcagcggactcggcaacgacgacgacggggac
tggtttccctgctacgacgacgccggtgatgaggagtgggcggaggacccgggcgccatg
gacacatcccacgatcccccggacgacgaggttgcctactttgacctgtgccacgaagtc
ggccccacggcggaacctcgcgaaacggattcgcccgtgtgttcctgcaccgacaagatc
ggactgcgggtgtgcatgcccgtccccgccccgtacgtcgtccacggttctctaacgatg
cggggggtggcacgggtcatccagcaggcggtgctgttggaccgagattttgtggaggcc
atcgggagctacgtaaaaaacttcctgttgatcgatacgggggtgtacgcccacggccac
agcctgcgcttgccgtattttgccaaaatcgcccccgacgggcctgcgtgcggaaggctg
ctgccagtgtttgtgatcccccccgcctgcaaagacgttccggcgtttgtcgccgcgcac
gccgacccgcggcgcttccattttcacgccccgcccacctatctcgcttccccccgggag
atccgtgtcctgcacagcctgggtggggactatgtgagcttctttgaaaggaaggcgtcc
cgcaacgcgctggaacactttgggcgacgcgagaccctgacggaggtcctgggtcggtac
aacgtacagccggatgcgggggggaccgtcgaggggttcgcatcggaactgctggggcgg
atagtcgcgtgcatcgaaacccactttcccgaacacgccggcgaatatcaggccgtatcc
gtccggcgggccgtcagtaaggacgactgggtcctcctacagctagtccccgttcgcggt
accctgcagcaaagcctgtcgtgtctgcgctttaagcacggccgggcgagtcgcgccacg
gcgcggacattcgtcgcgctgagcgtcggggccaacaaccgcctgtgcgtgtccttgtgt
cagcagtgctttgccgccaaatgcgacagcaaccgcctgcacacgctgtttaccattgac
gccggcacgccatgctcgccgtccgttccctgcagcacctctcaaccgtcgtcttga

DBGET integrated database retrieval system