KEGG   Viruses: 2703427Help
Entry
2703427           CDS       T40000                                 

Gene name
UL55, HHV1gp00p19
Definition
(RefSeq) Human alphaherpesvirus 1; nuclear protein UL55
Taxonomy
TAX:10298 [GN:T40073]
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Alphaherpesvirinae; Simplexvirus
Taxonomy
Organism
vg  Viruses (Human alphaherpesvirus 1)
SSDB OrthologParalogGFIT
Motif
Pfam: Herpes_UL55
Motif
Other DBs
NCBI-GeneID: 2703427
NCBI-ProteinID: YP_009137131
RS: NC_001806
UniProt: P10239 D3YPC0
Position
NC_001806:115497..116057
AA seq 186 aa AA seqDB search
MTATPLTNLFLRAPDITHVAPPYCLNATWQAETAMHTSKTDSACVAVRSYLVRASCETSG
TIHCFFFAVYKDTHHTPPLITELRNFADLVNHPPVLRELEDKRGVRLRCARPFSVGTIKD
VSGSGASSAGEYTINGIVYHCHCRYPFSKTCWMGASAALQHLRSISSSGMAARAAEHRRV
KIKIKA
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgacccccctcaccaacctgttcttacgggccccggacataacccacgtggcc
cccccttactgcctcaacgccacctggcaggccgaaacggccatgcacaccagcaaaacg
gactccgcttgcgtggccgtgcggagttacctggtccgcgcctcctgtgagaccagcggc
acaatccactgctttttctttgcggtatacaaggacacccaccacacccctccgctgatt
accgagctccgcaactttgcggacctggttaaccacccgccggtcctacgcgaactggag
gataagcgcggggtgcggctgcggtgtgcgcggccgtttagcgtcgggacgattaaggac
gtctctgggtccggcgcgtcctcggcgggagagtacacgataaacgggatcgtgtaccac
tgccactgtcggtatccgttctcaaaaacatgctggatgggggcctccgcggccctacag
cacctgcgctccatcagctccagcggcatggccgcccgcgcggcagagcatcgacgcgtc
aagattaaaattaaggcgtga

DBGET integrated database retrieval system