KEGG   Viruses: 2703476
Entry
2703476           CDS       T40000                                 

Symbol
NinI, lambdap70
Name
(RefSeq) Escherichia virus Lambda; serine/threonine protein phosphatase
Taxonomy
TAX:10710
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Lambdavirus
Organism
vg  Viruses (Escherichia virus Lambda)
SSDB
Motif
Pfam: Metallophos Metallophos_2 Metallophos_3 GP41
Other DBs
NCBI-GeneID: 2703476
NCBI-ProteinID: NP_040641
RS: NC_001416
UniProt: P03772 A0A0K2FI65
Structure
PDB: 
1G5B

Position
NC_001416:43224..43889
AA seq 221 aa
MRYYEKIDGSKYRNIWVVGDLHGCYTNLMNKLDTIGFDNKKDLLISVGDLVDRGAENVEC
LELITFPWFRAVRGNHEQMMIDGLSERGNVNHWLLNGGGWFFNLDYDKEILAKALAHKAD
ELPLIIELVSKDKKYVICHADYPFDEYEFGKPVDHQQVIWNRERISNSQNGIVKEIKGAD
TFIFGHTPAVKPLKFANQMYIDTGAVFCGNLTLIQVQGEGA
NT seq 666 nt   +upstreamnt  +downstreamnt
atgcgctattacgaaaaaattgatggcagcaaataccgaaatatttgggtagttggcgat
ctgcacggatgctacacgaacctgatgaacaaactggatacgattggattcgacaacaaa
aaagacctgcttatctcggtgggcgatttggttgatcgtggtgcagagaacgttgaatgc
ctggaattaatcacattcccctggttcagagctgtacgtggaaaccatgagcaaatgatg
attgatggcttatcagagcgtggaaacgttaatcactggctgcttaatggcggtggctgg
ttctttaatctcgattacgacaaagaaattctggctaaagctcttgcccataaagcagat
gaacttccgttaatcatcgaactggtgagcaaagataaaaaatatgttatctgccacgcc
gattatccctttgacgaatacgagtttggaaagccagttgatcatcagcaggtaatctgg
aaccgcgaacgaatcagcaactcacaaaacgggatcgtgaaagaaatcaaaggcgcggac
acgttcatctttggtcatacgccagcagtgaaaccactcaagtttgccaaccaaatgtat
atcgataccggcgcagtgttctgcggaaacctaacattgattcaggtacagggagaaggc
gcatga

DBGET integrated database retrieval system