KEGG   Viruses: 2717192
Entry
2717192           CDS       T40000                                 

Gene name
bbp10
Definition
(RefSeq) Bordetella virus BPP1; crystallin beta/gamma motif-containing protein
Taxonomy
TAX:194699
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; Rauchvirus
Organism
vg  Viruses (Bordetella virus BPP1)
SSDB
Motif
Pfam: LPD22 PBECR1 HOIP-UBA
Other DBs
NCBI-GeneID: 2717192
NCBI-ProteinID: NP_958679
RS: NC_005357
UniProt: Q775D4
Position
NC_005357:complement(6187..12345)
AA seq 2052 aa
MSNEFDAAVAGTLGQQPAQDTTADPFDAAVAGVLRPDQGQAARAGFVLASDTDPDAYAEA
QRVARRANLPIETVLNQPKEAKRQDTIGAIDFDTLGKTSPATAALLADVEKAKIAHDNVD
NMTGIESVLSSLGTAVKYLVSAPDQKNTLMGDIGAGFAQANRGAAGLFQSVFELPNNLVG
TILPANPLQPVADQFAQWGAQSKDLAKRLSPPQSDTLGSGVSSGVQSLTSNLLMLPLALL
PGGQPAALGGMASMTGGQSYQDARSQGLTPAQALPFAVSQATIEYATEKLPVSRLIGDLH
AGSPLLKTLAHQVATEVPGEQVATVLQDLNEWAVLPENKEKPFSAYLAERPSAAAQTLIA
TLVGVGGNVAVMRGIDRTITTADQRTQRAQAAQQQAELLARLNQLAAADKVLARDPDTFE
QFVANAAENGPVQQVFIDANTLMQSGLAEQVAAVSPAVAAQLPEALQTGGQVAIPVEEYA
ARIAPTEATQGLLDHLKTEPEGFSRAEAQQYMQSQAEELRAEVERALGEQQGDDAFKQSA
EAVRAAVKTQLDTAARFTPQVNDAYSSMVGNFYAVQAARLGTTPEALFQQYPLRVAAESV
AGGQQFDQEHGPFGPVLRDFQGDAKGAIAKLLEMKSGEAIGALHHPDIGDIDLVWGEEGT
RRSDGYGLAKLAKWHPEVLDDLQGILSAMKVTSRTENRVNLESADHRAGVRLTWDDQAKH
WLLTAFQKKGGVAGTRTGTTDLFVEDGTARPDDASDAIVDQKIDKFYQGGGRARGTFDPA
TLTVSLLKNADLSTFLHESGHFFLEVQLDIATRLAEKQRAGATLIDAETEVQRDAQTLLD
WFGVRDLAAWNDLDFEAKRAHHEQFARGFEAYLFEGKAPSIEMHGLFQRFRAWLLNVYRD
LKALNVELTPEVRNVFDRMLATGEQIALAEQGRSMMPLFATAEQAGMTPEEFAAYQALGV
DATNDAIQDLQARGLRDMQWLHNARGRIIKQLQKDAAARRADVRRQVAEEVNAQPVYRAD
RFLRYGELELPPGAPQNVRRAAEQANVDGAKLSLPALKEMYGEGENAIWRYLPTGKNGLA
ASEGMHPDTVAELFGFTSGDELVRRLLEAPPRGEEIEALTDVRMLEQFGELSTPEAIERA
ADSAIHNDARARFVATEANALARVAAGPTQQIGTDRRGRPIVRRVLPEAAREYARALVSR
LKVRDIRPGQYTNAEVRAARNADRAMKAGDLATAAAEKRNQLIQHQAARAAYDAQDEVER
GLRYLGKFAGDIKGIDVDYADQIANLLERFDLRKGQSLKAVDKRTALADWLRSQREAGFE
PDIPAELENEAYRTSYKNMTVEEFRGLVDSVRQIEHLGRLKRKLLTAADQRDYEAVRDEI
AGSIRAHAQGRSADTRTPTTNAGRAVQGLKRFWASHIKAATWARVMDGGKDGGPMWEYFV
RSANERGDMETTMRAEATGKLSEILAPVFALGKMGGKGQHFPTIGRSLNREARLTIALNM
GNEGNIQRLLGGEGWTPAQIAPVLQSLTAQEWQAVQAVWDHFEGYRPQIAAKERRVYGKE
PAWVEPRPLTITTADGQTLTLRGGYYPIKYDPAASQRAEEHSDAESARRQLQGAYTTATT
RRSFTKSRVEEVSGRPLLYTLSGLYSGVNDVIHDLAWHEWLIDANRLLRSQTIDGAIREH
YGPEAKQQFKTWAADIAEGERGADAAVDIALSRLRQGVSASGLGFNVMSALMQPLGITQS
IVRVGAPWVGRGVMKYLAAPVGLTREINAKSSFMANRARTRFRELNELRNQVQDGSATKE
WVGRNAYFLMMRCQQMVDVPTWWGAYEKAVAEGNDETRAVSLADQAVIDSQGGGQTKDLS
AIERGGPAQRLFTVFYSFMNTALNIGVAQTMSADTPAKRAKLAADYAMLYVVPAVLGYFL
KDALTPGDSGDDDPEKLAKKLLANQIDYLMGLMVVVREFGEAAKTVTGANDMGRDYTGPA
GLRLIADVGRFATQTHQGEFDDAFRKAAVNVVGDLFGLPSAQINRTVTGVQALAEGKTQN
PAAIGFGFQEAR
NT seq 6159 nt   +upstreamnt  +downstreamnt
atgagcaacgaattcgacgccgccgtagccggcacgctgggccagcaacccgcccaggac
actaccgccgatccgttcgatgccgctgttgccggtgtgctgcgtcccgaccaggggcag
gcagcgcgggccggtttcgttctcgcatcggacactgaccccgacgcctacgcggaagcg
cagcgcgtggcgcgtcgcgccaacctgccgattgaaaccgtgctcaaccagccgaaggaa
gcgaaacggcaggacaccatcggcgccatcgacttcgacacgctgggcaagacctcgccg
gccacggccgcgctgctggccgacgtggaaaaggccaagattgcgcacgacaacgtggac
aacatgaccggcatcgagtcggtactgtccagcctgggcacggcggtgaagtatctggtc
agcgcacccgaccagaagaacaccctcatgggcgatattggcgcggggttcgcccaggcc
aaccgcggcgcggccggtctgttccagtccgtctttgaattgcccaacaatctggtcggc
accattctgccggcaaatccgctgcaacctgtcgccgatcagttcgcacaatggggtgcg
cagtccaaagacctcgccaagcggctaagtccgccgcagtctgacaccttgggcagtggt
gtttcgtccggcgtacagtccctcacgtcgaacctgctcatgcttccgctggcactgctg
cccggcggccagccggcggccctgggcggcatggcttcgatgaccggcgggcagtcctat
caggatgcccgctcgcagggcctcacgccagcgcaggcgctgccctttgcggtgtcgcag
gcgaccatcgaatacgccactgaaaagctgccggtgtcgcgccttatcggcgacctgcac
gccggctcgccgctgctcaagaccctggcccatcaggtcgccaccgaggtgccgggcgag
caggtcgccaccgtactgcaagacctgaacgaatgggccgttctgcccgagaacaaggag
aaaccgttttccgcctacctggccgagcgtcccagcgccgcagcgcaaaccctcatcgcc
acgctagtgggcgtgggcgggaacgtggcggtcatgcgcggcattgaccgcaccatcacc
acggccgaccagcgcacgcaacgtgcgcaggcggcccagcagcaggccgaactgctcgca
cgtttgaaccaattggccgcagccgacaaggtgctcgcgcgcgacccggacacgttcgag
cagttcgtcgccaatgcggccgagaacggcccggtgcagcaggtgttcatcgacgccaat
acgctcatgcaatccggcctggccgaacaggtggccgcagtgtccccggctgtcgccgcg
caactgcccgaggccctgcaaaccggcgggcaggtcgccattccggtggaggaatacgcc
gcgcgcatcgcgccgaccgaagccacgcagggcctgctcgaccacctcaagaccgagccg
gaaggattcagccgcgccgaggcgcagcagtacatgcaatcccaggccgaagaactgcgg
gccgaagtcgagcgcgcccttggcgagcagcaaggcgacgacgcattcaagcaatcggcc
gaggccgtgcgcgctgccgtcaagacgcaactggacacggcggcgcgtttcacgccgcag
gtgaatgacgcctattcgtcgatggtcgggaatttctatgcggtgcaggctgcgcgcctg
ggtactacgcccgaggcgctgttccagcaatacccgttgcgcgtggcggcggaaagcgtg
gccggcggtcagcagttcgatcaagagcacggcccgttcgggccggtgctgcgcgacttc
cagggcgacgccaagggcgccattgccaagctgttggaaatgaaaagtggcgaggccatc
ggcgcgctgcatcacccggacatcggcgacatcgacttggtatggggagaagaaggcaca
cgccgcagcgacggctacggcctggcgaaactggcgaagtggcaccccgaggtgctggac
gacctacagggcatcctgtcagccatgaaggtcacgagccgcaccgagaaccgggtcaat
ttggaatccgccgaccatcgggccggcgtgcgcttgacgtgggacgatcaagcaaaacac
tggctgctgaccgccttccagaagaaaggaggcgtggccggtacgaggacaggcactacc
gacctttttgtcgaggatggcacggctcgccccgacgacgcctcggacgctattgtagat
cagaaaatcgacaagttctaccagggcgggggccgggcgcgcggcactttcgaccccgcc
acgctcaccgtttccctgcttaaaaatgcggatttgtccacgttcctgcatgaatccggc
cactttttcctcgaagtgcagctcgacatcgccacgcgcctggccgagaagcagcgcgcc
ggtgccacgctcatcgacgccgaaaccgaggtgcagcgtgatgcgcaaacgctgcttgac
tggttcggcgtgcgcgacctggccgcgtggaacgatctggacttcgaggcgaagcgcgcc
caccacgagcagttcgcccgcggcttcgaggcgtatctcttcgagggcaaggcgcccagc
attgaaatgcacggccttttccagcggttccgcgcgtggctgctcaacgtgtaccgcgac
ttgaaggccctgaacgtcgaactcacgcccgaggtgcgcaacgtgttcgaccggatgctc
gccaccggcgagcagatcgcactggccgaacagggccgcagcatgatgccactgttcgcc
acggcggaacaggctggcatgacgcccgaagaattcgctgcctatcaggccctcggcgtg
gacgcgaccaacgacgctattcaagacctgcaagcccgcggcctgcgcgacatgcagtgg
ctgcacaatgcacgcggccgcatcatcaagcaactgcaaaaggatgccgccgcccgccgc
gccgacgtgcgccgccaggtcgccgaggaagtcaatgcgcagccggtgtaccgggccgac
cgcttcctgcggtatggtgaactggaactgccgccgggcgcgccgcagaacgtgcgccgc
gccgccgagcaggccaacgtcgacggcgccaagttgtcgctgccggccctcaaggaaatg
tacggcgagggggaaaacgctatctggcgatacctgcccaccggcaagaacggcctcgcg
gccagtgaggggatgcaccccgataccgtggccgaattgttcggctttacgtctggtgac
gaactggtgcgccgcctgctggaagcgcccccgcgcggcgaggaaatcgaggcgcttacc
gacgtgcggatgctggaacagttcggcgaactgtccacgcccgaagccatcgagcgcgcc
gccgatagcgccattcacaatgatgcccgcgcccgcttcgtggcgaccgaggccaacgcg
ctggcccgcgttgcggctggcccgacccagcagatcggtactgaccggcgcggccgaccc
atcgtgcgccgcgtgctgcccgaagcggcacgtgaatacgcgcgcgccctggtgtcccgg
ctcaaggtgcgcgacatccgacccggccagtacaccaacgccgaggtgcgcgcggcacgc
aatgccgaccgcgcgatgaaggccggcgacctcgccaccgcagcggccgagaagcgcaac
cagcttatccagcaccaggccgcacgcgcggcctacgacgcccaggatgaggtcgagcgc
ggcctgcgatacctgggcaagttcgccggcgacatcaagggcatcgacgtggactatgcc
gaccagatcgccaatctgctggaacggttcgatctgcgcaagggccaaagcctcaaggcc
gtagacaagcgcacggccctggccgactggctacgcagccagcgcgaggccgggttcgag
ccggacatcccggccgaactcgaaaacgaggcgtaccgcacgtcctacaagaacatgacc
gttgaagaattccgcggcctggtcgatagcgtgcgtcagatcgaacacctgggccgcttg
aagcgcaagctgctgacggccgccgaccagcgcgactacgaggccgtgcgcgatgaaatc
gccggcagcatccgggcgcacgcgcagggacgcagcgccgacacccgcacgcccacaacc
aacgccggccgcgcggtgcagggcctcaaacgcttttgggcctcccatatcaaggcagcg
acctgggcgcgcgtcatggacggcggcaaggacggcggccctatgtgggaatatttcgtg
cgttcggcaaacgagcgcggcgacatggaaaccacgatgcgcgccgaggccacgggcaag
ctgtcggaaatcctcgcgccggtgttcgccctcggcaagatgggaggcaaagggcagcat
ttcccgaccatcggccgaagcctgaaccgcgaagcccgcctcaccatcgcgctgaacatg
ggcaacgagggcaacatccagcgcctgctgggcggcgaagggtggacgccggcgcagatc
gcgccggtgctgcaatcgctgactgcgcaggaatggcaagcggtgcaggcggtgtgggat
cacttcgagggctaccggccgcagatcgccgccaaagaacggcgcgtgtacggcaaggag
ccggcgtgggtcgagccgcgccccctgaccatcaccacggcagacggacagaccctgacc
ctacgcggcggctactatccgattaagtacgacccggccgcgagccagcgtgcggaagaa
cactcggacgccgaaagcgcgcgccgccagttgcaaggggcctataccaccgccactacg
cggcgcagcttcaccaagtcgcgcgtcgaggaagtgtccgggcgcccgctgctctatacc
ctgtccggtctgtattcgggcgtcaacgacgtgattcacgacctggcgtggcacgagtgg
ttgatcgacgccaaccggctgctgcgttcgcagaccatcgacggcgccatccgcgagcac
tacggccccgaggccaagcagcagttcaagacctgggcggccgacatcgccgagggtgag
cgcggcgcagatgctgccgtggacatcgcgctgtcccggctgcgtcagggcgtcagcgcg
tcgggcctgggcttcaacgtcatgagcgcccttatgcaaccgctgggcatcacgcagtcc
atcgtgcgcgtgggcgcgccgtgggtaggccgcggcgtcatgaagtacctggccgccccg
gtgggtcttacgcgcgagatcaacgccaagtcctcgttcatggcgaatcgggcgcggacg
cgcttccgcgaactcaacgagttgcgcaatcaggtgcaggatggttctgccacgaaggaa
tgggtcggccgcaatgcctatttcctgatgatgcgatgccagcagatggtggacgtgccg
acgtggtggggggcctacgaaaaggccgtcgccgagggcaacgacgaaacccgcgccgtg
tccctggctgaccaggcggtcatagattcccagggtggcgggcaaactaaagacctttcc
gctattgagcgcggcggcccagcgcagcggcttttcaccgtgttctattcgttcatgaac
acggccctgaacatcggcgtggcgcagaccatgagcgcggacactccggccaagcgcgcg
aagctggcggcggactacgccatgctctacgtggtgccggccgtgctgggctacttcctc
aaggatgcgctgacgcctggcgattcgggcgacgacgaccccgaaaaactcgccaagaaa
ctgctcgccaaccagatcgactacctgatgggcctcatggtcgtggtgcgtgagttcggg
gaagcagccaagaccgtgacaggcgccaacgacatgggccgcgactacaccgggccggcc
ggcctgcgcctgattgccgacgtgggccggttcgccacccagacgcaccagggcgagttc
gacgacgctttccgcaaagctgccgtcaatgtcgtgggcgacctgttcggcctgcccagc
gcgcagatcaaccgcaccgttaccggcgtgcaggccctggccgaaggcaaaacgcagaac
ccggcggctatcggcttcgggttccaagaggcccgctaa

DBGET integrated database retrieval system