KEGG   Viruses: 2777473Help
Entry
2777473           CDS       T40000                                 

Gene name
phd, P1_gp104
Definition
(RefSeq) Escherichia virus P1; Phd
  KO
K19165  antitoxin Phd
Taxonomy
TAX:10678
  Lineage
Viruses; dsDNA viruses, no RNA stage; Caudovirales; Myoviridae; P1virus
Taxonomy
Organism
vg  Viruses (Escherichia virus P1)
SSDB OrthologParalogGFIT
Motif
Pfam: PhdYeFM_antitox DUF1884
Motif
Other DBs
NCBI-GeneID: 2777473
NCBI-ProteinID: YP_006570
RS: NC_005856
UniProt: Q06253 Q71T67
Structure
PDB: 

Position
NC_005856:88046..88267
AA seq 73 aa AA seqDB search
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLF
DTLDSTNKELVNR
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
atgcaatccattaacttccgtaccgcgcgcggcaacctttctgaagtgctcaacaatgtt
gaagccggggaagaggttgaaatcacccgcagaggccgtgagccagcagtaattgtcagc
aaggctactttcgaagcctacaaaaaagcggcgctggatgctgaatttgcatccctgttt
gacaccctggactccaccaacaaggaactggttaaccgataa

DBGET integrated database retrieval system