KEGG   Viruses: 2943103Help
Entry
2943103           CDS       T40000                                 

Gene name
ArMVs2gp1
Definition
(RefSeq) Arabis mosaic virus; polyprotein P2
Taxonomy
TAX:12271 [GN:T40289]
  Lineage
Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; Secoviridae; Comovirinae; Nepovirus
Taxonomy
Organism
vg  Viruses (Arabis mosaic virus)
SSDB OrthologParalogGFIT
Motif
Pfam: NeA_P2 Nepo_coat Nepo_coat_C Nepo_coat_N
Motif
Other DBs
NCBI-GeneID: 2943103
NCBI-ProteinID: YP_053924
RS: NC_006056
UniProt: Q91HK4 U5KPY7
Position
NC_006056:296..3628
AA seq 1110 aa AA seqDB search
MAKFYYSDRRLACWAAGKNPHLGGSIESWLAAIKSDSSFRQTVKEDVQVNRLQPTAVRMF
SWKVGSGPIDNPEKCNWHYVLTGEVPAQPTEPVKAREVVVPPVKVIPSPPPVPRPYFRPV
GAFAPTRSGFIRATVERLSRKREESRAAALFAELPLEYPQGAPLVVPRGFAAMRWTYHAT
WRRWYDASDERALRVHPGGPALPPPPPPPPIQKPPSFEERLQAALERQSCARAFALETSL
GLNMAWLGTAAIPSTSVCCADGRTTGGQTIAQEADPINHRVTSNTAPGRAQWISERRSAL
RRREQANSLQSLAAQTDMTFEQARNAYLGAADMVEQGLPLLPPLRNAYAPRGLWRGPSTR
ANYTLDFRLNGIPTGQNTLEILYNPVADEEMDEYRDRGMSAVVIDALEIAINPFGMPGNP
TDLTVVATYGHERNMERAFIGSSSTFLGNGLARAIFFPGLQYSQEEPRRESIIRLYVAST
NATVDADSILAAISVGTLRQHIGSLHNRTVASSVHAAQVQGTTLRATMMGNAVVVSPEGS
LVTGTPEANVQIGSGSSMRMVGPLAWENVEEPGQTFTIRNRSRSMRVDRNADVGVALPRM
STTTRGLAGRGSVQVPKDCQAGRYLKTLDLRDMVSGFSGIQYEKWITAGLVMPDFKVVIR
YPANAFTGITWVMSFDAYNRITSSITTTASPAYTLSVPHWLLHHKNGTTSCDIDYGELCG
HAMWFNATTFESPKLHFTCLTGNNKELAADWEFVVELYAEFEAAKTFLGRPNFVYSADAF
NGSFKFLTIPPLEYDLSTTSAYKSVSLLLGQTLIDGTHKVYNYNNTLLSYYLGIGGVVKG
RVHICSPCTYGIVLRVVSEWNGVTNNWNQLFKYPGCYIGEDGNFEIEIRSPYHRTPLRLL
DAQAASAFTSTLNFYAISGPIAPSGETAKMPVVVQIDEIALPDLSVPSFPNDYFLWVDFS
AFTVDAEEYVIGSRFFDISSTTSTVHLGDNPFAHMIACHGLHHGILDLKLMWDLEGEFGK
SSGGVTITKLCGDKATGMDGASRVCALQNMGCETELYIGNFAGANPNSALSLYSRWLAIK
LDKARSMKMLRILCKPRGNFEFYGRTCFRV
NT seq 3333 nt NT seq  +upstreamnt  +downstreamnt
atggccaaattttattactccgacaggcgtttagcctgttgggctgctggaaagaaccct
caccttgggggttctattgagtcatggctggcggccattaaatctgactcctccttccgc
caaactgttaaggaggatgtacaggtgaacagattgcagcctacggctgtcaggatgttt
tcctggaaagtggggtctgggcccattgacaacccggaaaagtgcaactggcactacgtc
ctcacgggcgaggtgccagcgcaaccgaccgagccggtaaaagctcgagaggtggtggtg
ccacctgtgaaggtcattccttcaccgccccctgtgccaaggccttactttaggccagtt
ggggcttttgcaccgacccggtccgggtttatacgggccactgtggaaagactctcccgg
aaacgggaagagtcgagagctgcggcactctttgccgaattacccttggagtacccacaa
ggtgctccattggttgtcccccgtggtttcgcggccatgaggtggacttatcatgccacc
tggaggcggtggtatgacgccagtgatgagcgcgctttgcgcgttcatcctggtggccct
gctctgccccccccccccccccctcccccaatccaaaaaccaccctcttttgaggagagg
ttacaggctgctcttgaaaggcagtcctgtgctagggcttttgccctagaaacctcgcta
ggccttaacatggcctggctgggaacggctgctatccccagcacttctgtgtgctgtgct
gatggcaggactactggggggcaaactattgcccaggaggctgatcctattaatcatagg
gtcacttccaatacagcccctggtagggcacaatggatctcagagcgccgcagtgctctg
agaagaagggagcaagcaaatagcttgcaaagtcttgctgctcaaactgacatgacattt
gagcaggccaggaatgcgtatcttggtgctgctgacatggttgagcaaggcctaccgtta
ctacctccattgaggaatgcctacgcacctcgtggtctatggaggggaccttccactaga
gccaattatactcttgattttaggctcaatggaattcccaccgggcaaaatactttagaa
atattgtataatccggtggcagatgaggaaatggacgaataccgtgacaggggtatgtca
gcggtcgtgattgatgcactggaaattgctatcaatccttttggaatgccaggcaatccg
accgatcttactgtcgtagcgacatatgggcatgaacgtaacatggaacgtgcctttatt
ggctcttcgtcgacctttcttgggaatggtttggcgagagctattttctttcctggtttg
caatatagtcaggaagaacctaggcgcgaatctattattcgcctgtatgttgcttctact
aatgccactgttgatgctgattctatattagcagccattagtgttggcactctacgccag
cacattggttcgcttcataatagaacagtggcaagttctgtgcatgctgctcaggtgcag
ggcactactttaagagctactatgatgggtaatgccgttgtggtttctcctgaaggaagt
cttgtgactggaacccctgaagctaatgttcaaattggaagtggttctagcatgcgaatg
gttggtcccctggcatgggaaaacgttgaagaaccaggccagacttttaccataagaaac
cgctctcggtctatgcgagtagatcggaatgccgacgttggagttgctcttcctcggatg
agtactacaacgcggggtcttgctggtagaggttctgtgcaggtgcctaaagattgccag
gcagggagatatctgaaaacccttgatcttagagatatggtgagtgggttttcaggtata
cagtatgaaaagtggatcactgctggacttgttatgccagattttaaagtggtgatccgc
tatccagccaatgccttcacgggtattacgtgggttatgagctttgatgcttacaaccga
ataactagtagtatcacaactactgctagccctgcgtataccctttcggtccctcattgg
ctcttacatcataaaaatgggactacctcatgtgatattgattatggggagctttgcggt
cacgcgatgtggtttaatgccactacttttgaaagccctaaacttcatttcacatgcctc
actggaaataacaaggaacttgctgcggattgggaattcgtggttgagttgtatgctgag
tttgaggcagcaaaaacttttcttggaaggcctaactttgtttatagtgctgatgcattt
aatgggtctttcaagtttttgactatccccccactggaatatgacttaagtaccaccagt
gcttacaagagtgtgtcccttcttttgggtcaaactcttattgatggaactcataaggta
tataattataacaatacgcttttgagttactatcttggtataggtggtgtggtcaagggc
agagtgcatatatgtagcccttgtacttatggcatagtcctaagagttgttagtgaatgg
aacggggtcactaacaattggaatcaactatttaaataccccggatgttatatcggtgaa
gatgggaactttgagattgaaatacgttctccctatcatcgaactccactacgtttattg
gacgcacaggcagctagtgcttttacgagtacgctgaatttctatgcgatttcagggcca
attgccccaagtggagaaactgcaaaaatgccagtggtagtgcagattgatgaaattgca
cttccagatctttctgttccgtccttccccaatgattattttttatgggtggacttttca
gcatttactgttgatgctgaagagtatgtaatagggtccaggttttttgatatttcctct
actactagtactgtccaccttggagataatccttttgcccacatgatagcttgtcatgga
ctccatcatggtatccttgatcttaagttaatgtgggatttggagggcgaatttggaaag
agttccggtggagttaccattacaaaattgtgtggtgataaagctactggcatggatggt
gcatcccgtgtttgtgctttgcaaaatatgggatgtgaaactgaactgtacataggtaat
tttgctggtgccaatcctaattcagcattatctttgtacagtcgatggcttgccattaag
ttggataaggctaggagcatgaagatgctccgaattttatgcaagccaagagggaatttt
gagttttatggtagaacttgtttcagagtttaa

DBGET integrated database retrieval system