KEGG   Viruses: 2947618
Entry
2947618           CDS       T40000                                 

Gene name
ORFVgORF132
Definition
(RefSeq) Orf virus; ORF132 vascular endothelial growth factor-like protein
  KO
K22612  Poxvirus vascular endothelial growth factor A homolog
Taxonomy
TAX:10258 [GN:T40126]
  Lineage
Viruses; dsDNA viruses; Varidnaviria; Bamfordvirae; Nucleocytoviricota; Pokkesviricetes; Chitovirales; Poxviridae; Chordopoxvirinae; Parapoxvirus
Organism
vg  Viruses (Orf virus)
SSDB
Motif
Pfam: PDGF ETRAMP
Other DBs
NCBI-GeneID: 2947618
NCBI-ProteinID: NP_957909
RS: NC_005336
UniProt: Q6TVI8
Position
NC_005336:134777..135226
AA seq 149 aa
MKLTATIQVVVALLICMYNLPKCVSQDNDSPPSTNDWVRTLDKSGCRPRDTVVYLGDEYP
ENTNLQYNPRCVTVKRCSGCCNGEGQICTAVETRNTTVVVSVTSVSSSSGANSGVSNNLQ
RISLTEHTKCDCIGRTTTPPPTTTREPRR
NT seq 450 nt   +upstreamnt  +downstreamnt
atgaagttaacagctaccatacaagttgttgttgcattgttaatatgtatgtataatttg
ccaaaatgcgtgtctcaggataatgattcacctccttcaaccaatgactgggtgcgtaca
ctagacaaaagtggttgtagacccagagatactgttgtttatttgggagacgaatatcca
gaaaacactaacctacaatataatccccggtgcgtaactgttaaacgatgcagtggttgc
tgtaacggtgaaggtcaaatatgtacagctgttgaaacaagaaatacaaccgtagtcgtt
tcggttacaagtgtgtctagttcgtctggtgctaatagtggtgtatctaataaccttcaa
agaataagtcttacagaacacacaaagtgcgattgtattggtagaacaacgacaccacca
cctacgaccactagggaacctagacgataa

DBGET integrated database retrieval system