KEGG   Viruses: 33349959
Entry
33349959          CDS       T40000                                 

Gene name
CGV03_gp118
Definition
(RefSeq) Seal parapoxvirus; vascular endothelial growth factor-like protein
  KO
K22612  Poxvirus vascular endothelial growth factor A homolog
Taxonomy
TAX:187984
  Lineage
Viruses; dsDNA viruses; Varidnaviria; Bamfordvirae; Nucleocytoviricota; Pokkesviricetes; Chitovirales; Poxviridae; Chordopoxvirinae; Parapoxvirus; unclassified Parapoxvirus
Organism
vg  Viruses (Seal parapoxvirus)
SSDB
Motif
Pfam: PDGF
Other DBs
NCBI-GeneID: 33349959
NCBI-ProteinID: YP_009389414
RS: NC_035188
Position
NC_035188:125326..125793
AA seq 155 aa
MNFLRCWAHWSLALLLCFCHGLQAAPSAKSKSTSNANTWAEVYQKSYCQPMPTAVSISGE
HPSSKTRYNPPCVSLMRCGGCCNSENLECVPTETSNVTLPILQTMVTSNGRSSSMTDMVF
LEHTKCDCVPKSSNSESGNSESGNSENKNSREPRR
NT seq 468 nt   +upstreamnt  +downstreamnt
atgaactttttgcgctgttgggcacattggagcctcgcgctgcttctctgcttttgccat
gggttgcaagccgcaccttcggctaaaagtaagagcacttccaacgcaaacacgtgggcg
gaagtctaccaaaaaagctactgtcaacccatgccaactgctgtgagcatcagtggcgaa
caccctagttccaaaacacgctacaatcctccttgtgtgtctctaatgcggtgcggggga
tgctgtaatagcgaaaatttagagtgcgtgcccaccgaaacatcaaacgttactctgcca
attttgcagacaatggttacttcaaacggacgcagcagtagcatgacagatatggtgttc
ttagagcatacgaaatgtgactgcgtgccaaaaagcagtaactccgagagcgggaactcc
gagagcgggaactccgagaacaaaaatagtagagagcctaggcggtga

DBGET integrated database retrieval system