KEGG   Viruses: 3654619
Entry
3654619           CDS       T40000                                 

Gene name
NA, FLUAVH5N1_s6gp1
Definition
(RefSeq) Influenza A virus (A/goose/Guangdong/1/1996(H5N1)); neuraminidase
  KO
K19392  Influenza A virus neuraminidase [EC:3.2.1.18]
Taxonomy
TAX:93838 [GN:T40041]
  Lineage
Viruses; -ssRNA viruses; Riboviria; Orthornavirae; Negarnaviricota; Polyploviricotina; Insthoviricetes; Articulavirales; Orthomyxoviridae; Alphainfluenzavirus; Influenza A virus; H5N1 subtype
Organism
vg  Viruses (Influenza A virus)
SSDB
Motif
Pfam: Neur
Other DBs
NCBI-GeneID: 3654619
NCBI-ProteinID: YP_308668
RS: NC_007361
UniProt: Q9Q0U7
Position
NC_007361:21..1430
AA seq 469 aa
MNPNQKIITIGSICMVVGIISLMLQIGNIISIWVSHSIQTGNQHQAEPCNQSIITYENNT
WVNQTYVNISNTNFLTEKAVASVTLAGNSSLCPISGWAVHSKDNGIRIGSKGDVFVIREP
FISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPHRTLMSCPVGEAPSPYNSRFESVAWS
ASACHDGTSWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFT
VMTDGPSNGQASYKIFKMEKGKVVKSVELNAPNYHYEECSCYPDAGEITCVCRDNWHGSN
RPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSPNGAYGVKGFSFKYGNGVWIG
RTKSTNSRSGFEMIWDPNGWTGTDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCIRP
CFWVELIRGRPKESTIWTSGSSISFCGVNSDTVGWSWPDDAELPFTIDK
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgaatccaaatcagaagataataaccattggatcaatctgtatggtagttgggataatt
agcttgatgttacaaattgggaacataatctcaatatgggtcagtcattcaattcagaca
gggaatcaacaccaagctgaaccatgcaatcaaagcattattacttatgaaaacaacacc
tgggtaaatcaaacatatgtcaacatcagcaataccaattttcttactgaaaaagctgtg
gcttcagtaacattagcgggcaattcatctctttgccccattagcggatgggctgtacac
agtaaggacaacggtataagaatcggttccaagggggatgtgtttgttataagagagccg
ttcatctcatgctcccacttggaatgcagaactttctttttgactcagggagccttgctg
aatgacaagcactccaatgggaccgtcaaagacagaagccctcacagaacattgatgagt
tgtcctgtgggtgaggctccctccccatataactcaaggtttgagtctgttgcttggtcg
gcaagtgcttgccatgatggcaccagttggttgacaattggaatttctggcccagacaat
ggggctgtggctgtattgaaatacaacggcataataacagacactatcaagagttggagg
aacaacatactgagaactcaagagtctgaatgtgcatgtgtaaatggctcttgctttact
gtaatgactgacggaccaagtaatgggcaggcctcatataagatcttcaaaatggaaaaa
gggaaagtagttaaatcagtcgaattgaatgcccctaattatcactatgaggagtgctcc
tgttatcctgatgctggcgaaatcacatgtgtgtgcagggataattggcatggctcaaat
cggccatgggtatctttcaatcaaaatttggagtatcaaataggatatatatgcagtgga
gttttcggagacaatccacgccccaatgatggaacaggcagttgtggtccggtgtcccct
aacggggcatatggagtaaaagggttttcatttaaatacggcaatggtgtttggatcggg
agaaccaaaagcactaattccaggagcggctttgaaatgatttgggatccaaatgggtgg
actggaacggacagtagcttctcggtgaaacaagatatcgtagcaataactgattggtca
ggatatagcgggagttttgtccagcatccagaactgacaggattagattgcataagacct
tgtttctgggttgagctaatcagagggcggcccaaagagagcacaatttggactagtggg
agcagcatatctttttgtggtgtaaatagtgacactgtgggttggtcttggccagacgat
gccgagttgccattcaccattgacaagtag

DBGET integrated database retrieval system