KEGG   Viruses: 3655160
Entry
3655160           CDS       T40000                                 

Gene name
PB1-F2, FLUAVH3N2_s2p2
Definition
(RefSeq) Influenza A virus (A/New York/392/2004(H3N2)); PB1-F2 protein
  KO
K19397  Influenza A virus protein PB1-F2
Taxonomy
TAX:335341 [GN:T40037]
  Lineage
Viruses; -ssRNA viruses; Riboviria; Orthornavirae; Negarnaviricota; Polyploviricotina; Insthoviricetes; Articulavirales; Orthomyxoviridae; Alphainfluenzavirus; Influenza A virus; H3N2 subtype
Organism
vg  Viruses (Influenza A virus)
SSDB
Motif
Pfam: PB1-F2
Other DBs
NCBI-GeneID: 3655160
NCBI-ProteinID: YP_308848
RS: NC_007372
UniProt: Q464B0
Position
NC_007372:119..391
AA seq 90 aa
MEQEQDTPWTQSTEHTNIQRRGSGRQIQKLGHPNSTQLMDHYLRIMSQVDMHKQTVSWRL
WPSLKNPTQVSLRTHALKQWKSFNKQGWTN
NT seq 273 nt   +upstreamnt  +downstreamnt
atggaacaggaacaggatacaccatggacacagtcaacagaacacaccaatattcagaga
aggggaagtggacgacaaatacagaaactggggcaccccaactcaacccaattgatggac
cactacctgaggataatgagccaagtggatatgcacaaacagactgtgtcctggaggcta
tggccttccttgaagaatcccacccaggtatctttgagaactcatgccttgaaacaatgg
aagtcgttcaacaaacaagggtggacaaactaa

DBGET integrated database retrieval system