KEGG   Viruses: 3707496
Entry
3707496           CDS       T40000                                 

Gene name
K7R, VACWR039
Definition
(RefSeq) Vaccinia virus; unchracterized protein
Taxonomy
TAX:10245 [GN:T40360]
  Lineage
Viruses; dsDNA viruses; Poxviridae; Chordopoxvirinae; Orthopoxvirus
Organism
vg  Viruses (Vaccinia virus)
SSDB
Motif
Pfam: Poxvirus Cytochrom_C550
Other DBs
NCBI-GeneID: 3707496
NCBI-ProteinID: YP_232921
RS: NC_006998
UniProt: Q76ZX2 P68466 Q49QN9
Structure
PDB: 
3JRV 2K36

Position
NC_006998:29832..30281
AA seq 149 aa
MATKLDYEDAVFYFVDDDKICSRDSIIDLIDEYITWRNHVIVFNKDITSCGRLYKELMKF
DDVAIRYYGIDKINEIVEAMSEGDHYINFTKVHDQESLFATIGICAKITEHWGYKKISES
RFQSLGNITDLMTDDNINILILFLEKKLN
NT seq 450 nt   +upstreamnt  +downstreamnt
atggcgactaaattagattatgaggatgctgttttttactttgtggatgatgataaaata
tgtagtcgcgactccatcatcgatctaatagatgaatatattacgtggagaaatcatgtt
atagtgtttaacaaagatattaccagttgtggaagactgtacaaggaattgatgaagttc
gatgatgtcgctatacggtactatggtattgataaaattaatgagattgtcgaagctatg
agcgaaggagaccactacatcaattttacaaaagtccatgatcaggaaagtttattcgct
accataggaatatgtgctaaaatcactgaacattggggatacaaaaagatttcagaatct
agattccaatcattgggaaacattacagatctgatgaccgacgataatataaacatcttg
atactttttctagaaaaaaaattgaattga

DBGET integrated database retrieval system