KEGG   Viruses: 3707502
Entry
3707502           CDS       T40000                                 

Gene name
F6L, VACWR045
Definition
(RefSeq) Vaccinia virus; hypothetical protein
Taxonomy
TAX:10245 [GN:T40360]
  Lineage
Viruses; dsDNA viruses; Poxviridae; Chordopoxvirinae; Orthopoxvirus
Organism
vg  Viruses (Vaccinia virus)
SSDB
Motif
Pfam: Orthopox_F6
Other DBs
NCBI-GeneID: 3707502
NCBI-ProteinID: YP_232927
RS: NC_006998
UniProt: Q76ZW9 P68602 P68603 Q49QN0
Position
NC_006998:complement(34947..35171)
AA seq 74 aa
MSKILTFVKNKIIDLINNDQIKYSRVIMIEESDSLLPVDEVHANHGFDCVEMIDENISNE
NIEQYKTESFFTIN
NT seq 225 nt   +upstreamnt  +downstreamnt
atgagtaaaatactcacgtttgttaaaaataagataattgacttgattaataatgaccaa
attaaatattctagagttataatgatagaagagtccgatagtcttttaccggttgatgag
gtgcatgctaaccacggatttgactgtgtggagatgatagatgaaaatataagcaatgag
aatatcgaacagtataaaaccgaatctttttttacaataaattga

DBGET integrated database retrieval system