KEGG   Viruses: 3707505
Entry
3707505           CDS       T40000                                 

Gene name
F9L, VACWR048
Definition
(RefSeq) Vaccinia virus; S-S bond formation pathway protein
Taxonomy
TAX:10245 [GN:T40360]
  Lineage
Viruses; dsDNA viruses; Poxviridae; Chordopoxvirinae; Orthopoxvirus
Organism
vg  Viruses (Vaccinia virus)
SSDB
Motif
Pfam: L1R_F9L Ferric_reduct
Other DBs
NCBI-GeneID: 3707505
NCBI-ProteinID: YP_232930
RS: NC_006998
UniProt: P68453 Q76RE4 A0A0A1CPC8
Structure
PDB: 
6CJ6

Position
NC_006998:complement(35834..36472)
AA seq 212 aa
MAETKEFKTLYNLFIDSYLQKLAQHSIPTNVTCAIHIGEVIGQFKNCALRITNKCMSNSR
LSFTLMVESFIEVISLLPEKDRRAIAEEIGIDLDDVPSAVSKLEKNCNAYAEVNNIIDIQ
KLDIGECSAPPGQHMLLQIVNTGSAEANCGLQTIVKSLNKIYVPPIIENRLPYYDPWFLV
GVAIILVIFTVAICSIRRNLALKYRYGTFLYV
NT seq 639 nt   +upstreamnt  +downstreamnt
atggcggaaactaaagagtttaaaactttgtataatctttttatagatagttatttacaa
aaattagctcaacattctatccctactaatgtcacttgtgctattcatataggagaggtt
ataggacagtttaaaaattgcgcgctccgaataactaacaaatgcatgagtaattctcga
cttagtttcacactcatggttgaatcatttattgaagtgatttcattgcttccggaaaag
gatagaagagctatcgctgaagaaataggaatagatctagacgatgtacctagtgcggta
tccaagctagaaaagaactgtaatgcgtatgcggaggttaataatattatagatatacag
aaattagatatcggagaatgttcggctccgcccggtcaacatatgcttttacagatagtt
aatacaggatccgcggaagcaaattgtggtttacagacaattgttaagtccttaaataaa
atatacgttccacctattatcgaaaaccgattgccgtattacgatccgtggtttctagtg
ggtgtagcaattattctagttatttttactgtagctatttgttctattagacgaaatctg
gctcttaaatacagatacggaacgtttttatacgtttaa

DBGET integrated database retrieval system