KEGG   Viruses: 3707515
Entry
3707515           CDS       T40000                                 

Gene name
D12L, VACWR117
Definition
(RefSeq) Vaccinia virus; small subunit of mRNA capping enzyme
Taxonomy
TAX:10245 [GN:T40360]
  Lineage
Viruses; dsDNA viruses; Poxviridae; Chordopoxvirinae; Orthopoxvirus
Organism
vg  Viruses (Vaccinia virus)
SSDB
Motif
Pfam: Pox_mRNA-cap
Other DBs
NCBI-GeneID: 3707515
NCBI-ProteinID: YP_232999
RS: NC_006998
UniProt: P04318 Q49QD9
Structure
PDB: 
2VDW 4CKB 4CKE 4CKC

Position
NC_006998:complement(107332..108195)
AA seq 287 aa
MDEIVKNIREGTHVLLPFYETLPELNLSLGKSPLPSLEYGANYFLQISRVNDLNRMPTDM
LKLFTHDIMLPESDLDKVYEILKINSVKYYGRSTKADAVVADLSARNKLFKRERDAIKSN
NHLTENNLYISDYKMLTFDVFRPLFDFVNEKYCIIKLPTLFGRGVIDTMRIYCSLFKNVR
LLKCVSDSWLKDSAIMVASDVCKKNLDLFMSHVKSVTKSSSWKDVNSVQFSILNNPVDTE
FINKFLEFSNRVYEALYYVHSLLYSSMTSDSKSIENKHQRRLVKLLL
NT seq 864 nt   +upstreamnt  +downstreamnt
atggatgaaattgtaaaaaatatccgggagggaacgcatgtccttcttccattttatgaa
acattgccagaacttaatctgtctctaggtaaaagcccattacctagtctggaatacgga
gctaattactttcttcagatttctagagttaatgatctaaatagaatgccgaccgacatg
ttaaaactttttacacatgatatcatgttaccagaaagcgatctagataaagtctatgaa
attttaaagattaatagcgtaaagtattatgggaggagtactaaagcggacgccgtagtt
gccgacctcagcgcacgcaataaactgttcaaacgtgaacgagatgctattaaatctaat
aatcatctcactgaaaacaatctatacattagcgattataagatgttaaccttcgacgtg
tttcgaccattatttgattttgtaaacgaaaaatattgtattattaaacttccaacttta
ttcggtagaggtgtaatcgatactatgagaatatattgtagtctctttaaaaatgttaga
ctgctaaaatgcgtaagcgatagctggttaaaagatagcgccattatggtggctagtgat
gtttgtaaaaaaaatttggatttatttatgtctcatgttaagtccgtcactaagtcttct
tcttggaaggatgtgaacagtgttcaatttagtattttaaacaatccagtggatacggaa
ttcattaataagttcttagagttttcgaatagagtatacgaagctctctattacgttcac
tcgttgctttattctagtatgacttctgattcaaaaagtatcgaaaacaaacatcagaga
agactagttaaactactgctgtga

DBGET integrated database retrieval system