KEGG   Viruses: 3707521
Entry
3707521           CDS       T40000                                 

Gene name
A4L, VACWR123
Definition
(RefSeq) Vaccinia virus; 39kDa core protein
Taxonomy
TAX:10245 [GN:T40360]
  Lineage
Viruses; dsDNA viruses; Poxviridae; Chordopoxvirinae; Orthopoxvirus
Organism
vg  Viruses (Vaccinia virus)
SSDB
Motif
Pfam: Orthopox_A5L
Other DBs
NCBI-GeneID: 3707521
NCBI-ProteinID: YP_233005
RS: NC_006998
UniProt: P29191 Q6LD94
Position
NC_006998:complement(113281..114126)
AA seq 281 aa
MDFFNKFSQGLAESSTPKSSIYYSEEKDPDTKKDEAIEIGLKSQESYYQRQLREQLARDN
MTVASRQPIQPLQPTIHITPQPVPTATPAPILLPSSTVPTPKPRQQTNTSSDMSNLFDWL
SEDTDAPASSLLPALTPSNAVQDIISKFNKDQKTTTPPSTQPSQTLPTTTCTQQSDGNIS
CTTPTVTPPQPPIVATVCTPTPTGGTVCTTAQQNPNPGAASQQNLDDMALKDLMSNVERD
MHQLQAETNDLVTNVYDAREYTRRAIDQILQLVKGFERFQK
NT seq 846 nt   +upstreamnt  +downstreamnt
atggacttctttaacaagttctcacaggggctggcagaatcctctacaccaaagtcgtca
atctattattctgaagaaaaggatccggatacgaaaaaggatgaagcgattgaaatagga
ctaaagtctcaagagtcgtattatcaaagacagttgcgagaacaactagctagagataat
atgacggtcgccagcagacagcctatccaaccgctacaaccaactattcatataactcca
cagccggttccaacagctacaccggctcctattcttctacctagtagtactgttcctaca
ccaaaaccacgacaacaaactaatacatcatctgatatgtctaatctttttgattggctg
tctgaagatactgatgcgccggcgagttcactccttccagcgttgacgccgagcaatgct
gttcaggatattatctctaaatttaataaagatcaaaagacgacgacaccgccatctacc
caaccttctcagacgttaccaacaactacatgtacacaacaatcggatggaaatatttct
tgtactactccaacggttacacctcctcaacctcctattgtggccactgtatgtactcct
acacctactggtggtacagtatgtacaacagcacaacaaaatccaaatccaggagcagca
tctcaacaaaatctagacgatatggcccttaaggatctcatgtcgaatgttgaaagagat
atgcaccaacttcaggccgaaacaaacgatctggtgacgaacgtatatgatgcaagggag
tatacgcgtagggcaatagatcaaattctacaactagtcaaaggttttgaacgattccaa
aagtaa

DBGET integrated database retrieval system