KEGG   Viruses: 3707535
Entry
3707535           CDS       T40000                                 

Gene name
G3L, VACWR079
Definition
(RefSeq) Vaccinia virus; Hypothetical protein
Taxonomy
TAX:10245 [GN:T40360]
  Lineage
Viruses; dsDNA viruses; Poxviridae; Chordopoxvirinae; Orthopoxvirus
Organism
vg  Viruses (Vaccinia virus)
SSDB
Motif
Pfam: Chordopox_G3 LCCL
Other DBs
NCBI-GeneID: 3707535
NCBI-ProteinID: YP_232961
RS: NC_006998
UniProt: P68458 Q76RD5 H2DV02
Position
NC_006998:complement(70749..71084)
AA seq 111 aa
MASLLYLILFLLFVCISYYFTYYPTNKLQAAVMETDRENAIIRQRNDEIPTRTLDTAIFT
DASTVASAQIHLYYNSNIGKIIMSLNGKKHTFNLYDDNDIRTLLPILLLSK
NT seq 336 nt   +upstreamnt  +downstreamnt
atggcatctttattatatcttattttatttttgttattcgtatgtatttcttattatttt
acatattatccgaccaataaacttcaggcagctgtaatggaaacagatagagaaaacgct
attattagacagcgaaatgatgaaataccgactagaacattagatacagctatatttacc
gatgcatcaaccgtcgcgagtgcgcaaatacacctatattataattccaatattggtaaa
attataatgtcacttaatggtaaaaaacacacctttaatttatacgatgataacgacata
cgaacattacttcctattttactccttagtaaatga

DBGET integrated database retrieval system