KEGG   Viruses: 3707536
Entry
3707536           CDS       T40000                                 

Gene name
G2R, VACWR080
Definition
(RefSeq) Vaccinia virus; transcriptional elongation factor
Taxonomy
TAX:10245 [GN:T40360]
  Lineage
Viruses; dsDNA viruses; Poxviridae; Chordopoxvirinae; Orthopoxvirus
Organism
vg  Viruses (Vaccinia virus)
SSDB
Motif
Pfam: Chordopox_G2
Other DBs
NCBI-GeneID: 3707536
NCBI-ProteinID: YP_232962
RS: NC_006998
UniProt: P68456 Q76RD4 M9WHL9
Position
NC_006998:71078..71740
AA seq 220 aa
MPFRDLILFNLSKFLLTEDEESLEIVSSLCRGFEISYDDLITYFPDRKYHKYISKVFEHV
DLSEELSMEFHDTTLRDLVYLRLYKYSKCIRPCYKLGDNLKGIVVIKDRNIYIREANDDL
IEYLLKEYTPQIYTYSNERVPITGSKLILCGFSQVTFMAYTTSHITTNKKVDVLVSKKCI
DELVDPINYQILQNLFDKGSGTINKILRKIFYSVTGGQTP
NT seq 663 nt   +upstreamnt  +downstreamnt
atgccatttagagatctaattttgttcaacttgtccaaattcctacttacagaagatgag
gaatcgttggagatagtgtcttccttatgtagaggatttgaaatatcttatgatgacttg
ataacttactttccagataggaaataccataaatatatttctaaagtatttgaacatgta
gatttatcggaggaattaagtatggaattccatgatacaactttgcgagatttagtctat
cttagattgtacaagtattccaagtgtatacggccgtgttataaattaggagataatcta
aaaggcatagttgttataaaggacaggaatatttatattagggaagcaaatgatgacttg
atagaatatctcctcaaggaatacactcctcagatttatacatattctaatgagcgcgtc
cccataactggttcaaaattaattctttgtggattttctcaagttacatttatggcgtat
acaacgtcgcatataacaacaaataaaaaggtagatgttctcgtttccaaaaaatgtata
gatgaactagtcgatccaataaattatcaaatacttcaaaatttatttgataaaggaagc
ggaacaataaacaaaatactcaggaagatattttattcggtaacaggtggccaaactcca
tag

DBGET integrated database retrieval system