KEGG   Viruses: 3707551
Entry
3707551           CDS       T40000                                 

Gene name
J3R, VACWR095
Definition
(RefSeq) Vaccinia virus; poly(A) polymerase small subunit
  KO
K21516  Orthopoxvirus cap-specific mRNA (nucleoside-2'-O-)-methyltransferase [EC:2.1.1.57]
Taxonomy
TAX:10245 [GN:T40360]
  Lineage
Viruses; dsDNA viruses; Poxviridae; Chordopoxvirinae; Orthopoxvirus
Organism
vg  Viruses (Vaccinia virus)
SSDB
Motif
Pfam: PARP_regulatory DUF4218 DUF1177
Other DBs
NCBI-GeneID: 3707551
NCBI-ProteinID: YP_232977
RS: NC_006998
UniProt: Q76ZT1 P07617 A0A2I6TDT0
Structure
PDB: 

Position
NC_006998:81323..82324
AA seq 333 aa
MDVVSLDKPFMYFEEIDNELDYEPESANEVAKKLPYQGQLKLLLGELFFLSKLQRHGILD
GATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEY
LRSIKKQLHPSKIILISDVRSKRGGNEPSTADLLSNYALQNVMISILNPVASSLKWRCPF
PDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLN
KIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIPTTS
TEKVSHEPIQRKISSKNSMSKNRNSKRSVRSNK
NT seq 1002 nt   +upstreamnt  +downstreamnt
atggatgttgtgtcgttagataaaccgtttatgtattttgaggaaattgataatgagtta
gattacgaaccagaaagtgcaaatgaggtcgcaaaaaaactgccgtatcaaggacagtta
aaactattactaggagaattattttttcttagtaagttacagcgacacggtatattagat
ggtgccaccgtagtgtatataggatctgctcccggtacacatatacgttatttgagagat
catttctataatttaggagtgatcatcaaatggatgctaattgacggccgccatcatgat
cctattttaaatggattgcgtgatgtgactctagtgactcggttcgttgatgaggaatat
ctacgatccatcaaaaaacaactgcatccttctaagattattttaatttctgatgtgaga
tccaaacgaggaggaaatgaacctagtacggcggatttactaagtaattacgctctacaa
aatgtcatgattagtattttaaaccccgtggcgtctagtcttaaatggagatgcccgttt
ccagatcaatggatcaaggacttttatatcccacacggtaataaaatgttacaacctttt
gctccttcatattcagctgaaatgagattattaagtatttataccggtgagaacatgaga
ctgactcgagttaccaaatcagacgctgtaaattatgaaaaaaagatgtactaccttaat
aagatcgtccgtaacaaagtagttgttaactttgattatcctaatcaggaatatgactat
tttcacatgtactttatgctgaggaccgtgtactgcaataaaacatttcctactactaaa
gcaaaggtactatttctacaacaatctatatttcgtttcttaaatattccaacaacatca
actgaaaaagttagtcatgaaccaatacaacgtaaaatatctagcaaaaattctatgtct
aaaaacagaaatagcaagagatccgtacgcagtaataaatag

DBGET integrated database retrieval system