KEGG   Viruses: 3707552
Entry
3707552           CDS       T40000                                 

Gene name
J4R, VACWR096
Definition
(RefSeq) Vaccinia virus; DNA-dependent RNA polymerase subunit rpo22
Taxonomy
TAX:10245 [GN:T40360]
  Lineage
Viruses; dsDNA viruses; Poxviridae; Chordopoxvirinae; Orthopoxvirus
Organism
vg  Viruses (Vaccinia virus)
SSDB
Motif
Pfam: Pox_RNA_Pol_22
Other DBs
NCBI-GeneID: 3707552
NCBI-ProteinID: YP_232978
RS: NC_006998
UniProt: P68609 Q76RC8 A4GDF1
Position
NC_006998:82239..82796
AA seq 185 aa
MNQYNVKYLAKILCLKTEIARDPYAVINRNVLLRYTTDIEYNDLVTLITVRHKIDSMKTV
FQVFNESSINYTPVDDDYGEPIIITSYLQKGHNKFPVNFLYIDVVISDLFPSFVRLDTTE
TNIVNSVLQTGDGKKTLRLPKMLETEIVVKILYRPNIPLKIVRFFRNNMVTGVEIADRSV
ISVAD
NT seq 558 nt   +upstreamnt  +downstreamnt
atgaaccaatacaacgtaaaatatctagcaaaaattctatgtctaaaaacagaaatagca
agagatccgtacgcagtaataaatagaaacgtactactgagatatactaccgatatagag
tataatgatttagttactttaataaccgttagacataaaattgattctatgaaaactgtg
tttcaggtatttaacgaatcatccataaattatactccggttgatgatgattatggagaa
ccaatcattataacatcgtatcttcaaaaaggtcataacaagtttcctgtaaattttcta
tacatagatgtggtaatatctgacttatttcctagctttgttagactagatactacagaa
actaatatagttaatagtgtactacaaacaggcgatggtaaaaagactcttcgtcttccc
aaaatgttagagacggaaatagttgtcaagattctctatcgccctaatataccattaaaa
attgttagatttttccgcaataacatggtaactggagtagagatagccgatagatctgtt
atttcagtcgctgattaa

DBGET integrated database retrieval system