KEGG   Viruses: 3707553
Entry
3707553           CDS       T40000                                 

Gene name
J5L, VACWR097
Definition
(RefSeq) Vaccinia virus; late 16kDa putative membrane protein
Taxonomy
TAX:10245 [GN:T40360]
  Lineage
Viruses; dsDNA viruses; Poxviridae; Chordopoxvirinae; Orthopoxvirus
Organism
vg  Viruses (Vaccinia virus)
SSDB
Motif
Pfam: Pox_G9-A16
Other DBs
NCBI-GeneID: 3707553
NCBI-ProteinID: YP_232979
RS: NC_006998
UniProt: Q76VD9 P07618 Q49PN6
Position
NC_006998:complement(82857..83258)
AA seq 133 aa
MTDEQIYAFCDANKDDIRCKCIYPDKSIVRIGIDTRLPYYCWYEPCKRSDALLPASLKKN
ITKCNVSDCTISLGNVSITDSKLDVNNVCDSKRVATENIAVRYLNQEIRYPIIDIKWLPI
GLLALAILILAFF
NT seq 402 nt   +upstreamnt  +downstreamnt
atgacggacgaacaaatttatgcattctgtgatgctaacaaagacgatatacgatgtaaa
tgtatttatcctgataaaagcatagtacggataggaatagatacaagattaccctattat
tgttggtacgagccatgtaaacgaagcgatgcgttgttaccagcctctttaaaaaaaaat
ataacaaaatgcaatgtatcggattgtaccatttcattgggaaacgtttccattacagat
agtaaattagatgtaaataatgtttgtgattccaaacgagtagctaccgagaatatagct
gtccgctatctgaatcaggaaattagataccctattatagatatcaaatggcttccgatt
ggattactagcgttagctattttaatattagcatttttctaa

DBGET integrated database retrieval system