KEGG   Viruses: 3707596
Entry
3707596           CDS       T40000                                 

Gene name
E7R, VACWR063
Definition
(RefSeq) Vaccinia virus; putative myristoylated protein
Taxonomy
TAX:10245 [GN:T40360]
  Lineage
Viruses; dsDNA viruses; Poxviridae; Chordopoxvirinae; Orthopoxvirus
Organism
vg  Viruses (Vaccinia virus)
SSDB
Motif
Pfam: E7R DUF2704
Other DBs
NCBI-GeneID: 3707596
NCBI-ProteinID: YP_232945
RS: NC_006998
UniProt: P68446 Q76RE3 Q1M1Q6
Position
NC_006998:52183..52683
AA seq 166 aa
MGTAATIQTPTKLMNKENAEMILEKIVDHIVMYISDESSDSENNPEYIDFRNRYEDYRSL
IIKSDHEFVKLCKNHAEKSSPETQQMIIKHIYEQYLIPVSEVLLKPIMSMGDIITYNGCK
DNEWMLEQLSTLNFNNLRTWNSCSIGNVTRLFYTFFSYLMKDKLNI
NT seq 501 nt   +upstreamnt  +downstreamnt
atgggaactgctgcaacaattcagactcccaccaaattaatgaataaagaaaatgcagaa
atgattttggaaaaaattgttgatcatatagttatgtatattagtgacgaatcaagtgat
tcagaaaataatcctgaatatattgattttcgtaacagatacgaagactatagatctctc
attataaaaagtgatcacgagtttgtaaagctatgtaaaaatcatgcagagaaaagttct
ccagaaacgcaacaaatgattatcaaacacatatacgaacaatatcttattccagtatct
gaagtactattaaaacctataatgtccatgggtgacataattacatataacggatgtaaa
gacaatgaatggatgctagaacaactctctaccctaaactttaacaatctccgcacatgg
aactcatgtagcataggcaatgtaacgcgtctgttttatacattttttagttatctgatg
aaagataaactaaatatataa

DBGET integrated database retrieval system