KEGG   Viruses: 3707599Help
Entry
3707599           CDS       T40000                                 

Gene name
E10R, VACWR066
Definition
(RefSeq) Vaccinia virus; sulfhydryl oxidase
Taxonomy
TAX:10245 [GN:T40360]
  Lineage
Viruses; dsDNA viruses; Poxviridae; Chordopoxvirinae; Orthopoxvirus
Taxonomy
Organism
vg  Viruses (Vaccinia virus)
SSDB OrthologParalogGFIT
Motif
Pfam: Pox_E10 Evr1_Alr
Motif
Other DBs
NCBI-GeneID: 3707599
NCBI-ProteinID: YP_232948
RS: NC_006998
UniProt: P23373 Q76RE2 M9WKV4
Position
NC_006998:56688..56975
AA seq 95 aa AA seqDB search
MNPKHWGRAVWTIIFIVLSQAGLDGNIEACKRKLYTIVSTLPCPACRRHATIAIEDNNVM
SSDDLNYIYYFFIRLFNNLASDPKYAIDVTKVNPL
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgaatcccaaacattggggaagagccgtatggaccattatttttatagtactttcgcaa
gcgggtttagacggcaacatagaagcgtgtaaacgaaaactatatactatagttagcact
cttccatgtcctgcatgtagacggcacgcgactatcgctatagaggacaataatgtcatg
tctagcgatgatctgaattatatttattattttttcatcagattatttaacaatttggca
tctgatcccaaatacgcgatcgatgtgacaaaggttaaccctttataa

DBGET integrated database retrieval system