KEGG   Viruses: 3707600
Entry
3707600           CDS       T40000                                 

Gene name
E11L, VACWR067
Definition
(RefSeq) Vaccinia virus; putative virion core protein
Taxonomy
TAX:10245 [GN:T40360]
  Lineage
Viruses; dsDNA viruses; Poxviridae; Chordopoxvirinae; Orthopoxvirus
Organism
vg  Viruses (Vaccinia virus)
SSDB
Motif
Pfam: Chordopox_E11
Other DBs
NCBI-GeneID: 3707600
NCBI-ProteinID: YP_232949
RS: NC_006998
UniProt: P68448 Q76RE1 Q49PR7
Position
NC_006998:complement(56970..57359)
AA seq 129 aa
MELVNIFLETDAGRVKFAIKNTDDVCASELINKFVELLSEYIHIDQSEFYLVVKDKDIFY
FKCDRGSISIVNNEFYVFDEPLLFVKDFTNVTGVEFIVTETMPCRIIPKNNHAVISVVTN
HKFYNGLSL
NT seq 390 nt   +upstreamnt  +downstreamnt
atggaactcgttaatatttttttagaaacggatgctggaagagtaaagtttgccataaaa
aataccgacgatgtatgtgcctcggagttaataaataaatttgtggaactgttaagtgaa
tacattcacattgaccaatcagaattttatttggtggtaaaggataaggatattttttat
tttaagtgtgatagggggtctatttcgattgtaaacaatgagttttatgtctttgacgaa
cccttgctgtttgttaaagatttcactaatgtaacgggggttgaattcatagtcacagaa
accatgccgtgtagaattataccaaaaaataatcacgcggttatttcagtcgtgactaat
cataagttttataatgggttaagtttataa

DBGET integrated database retrieval system