KEGG   Viruses: 3707602
Entry
3707602           CDS       T40000                                 

Gene name
O2L, VACWR069
Definition
(RefSeq) Vaccinia virus; glutaredoxin
Taxonomy
TAX:10245 [GN:T40360]
  Lineage
Viruses; dsDNA viruses; Poxviridae; Chordopoxvirinae; Orthopoxvirus
Organism
vg  Viruses (Vaccinia virus)
SSDB
Motif
Pfam: Glutaredoxin DUF836
Other DBs
NCBI-GeneID: 3707602
NCBI-ProteinID: YP_232951
RS: NC_006998
UniProt: Q76ZV3 P68691 P68692 Q49Q11
Position
NC_006998:complement(59394..59720)
AA seq 108 aa
MAEEFVQQRLANNKVTIFVKYTCPFCRNALDILNKFSFKRGAYEIVDIKEFKPENELRDY
FEQITGGRTVPRIFFGKTSIGGYSDLLEIDNMDALGDILSSIGVLRTC
NT seq 327 nt   +upstreamnt  +downstreamnt
atggccgaggaatttgtacaacaaaggttggccaataacaaagtgacaatttttgtcaag
tatacatgtcctttttgtagaaatgcactggatattctaaataagtttagtttcaaaaga
ggagcgtatgaaattgtcgatattaaagaatttaaacccgaaaatgaattgcgtgactat
tttgaacaaattactggtggtagaactgttcctagaatcttttttgggaaaacttctatt
ggtggatatagcgacctgttggaaatagacaacatggacgcattgggtgatattctatca
tctattggggtattgagaacttgttga

DBGET integrated database retrieval system