KEGG   Viruses: 3707604
Entry
3707604           CDS       T40000                                 

Gene name
I2L, VACWR071
Definition
(RefSeq) Vaccinia virus; IMV membrane protein
Taxonomy
TAX:10245 [GN:T40360]
  Lineage
Viruses; dsDNA viruses; Poxviridae; Chordopoxvirinae; Orthopoxvirus
Organism
vg  Viruses (Vaccinia virus)
SSDB
Motif
Pfam: Pox_EPC_I2-L1 CoV_S2 vMSA DUF3671 DUF2207 ATG27 zf-LITAF-like DUF5542
Other DBs
NCBI-GeneID: 3707604
NCBI-ProteinID: YP_232953
RS: NC_006998
UniProt: P68605 P68606 Q76RD9 A0A0N9E118
Position
NC_006998:complement(60811..61032)
AA seq 73 aa
MDKLYAAIFGVFMGSPEDDLTDFIEIVKSVLSDEKTVTSTNNTGCWGWYWLIIIFFIVLI
LLLLIYLYLKVVW
NT seq 222 nt   +upstreamnt  +downstreamnt
atggataagttgtacgccgctatatttggtgtatttatggggtctccggaagatgatttg
acagactttatagaaattgttaaatctgttctaagtgatgagaaaacagtcacatcaact
aataataccggttgttggggttggtattggttaattattattttttttatagttcttatt
ctactactattgatatatttgtatttaaaagttgtttggtga

DBGET integrated database retrieval system