KEGG   Viruses: 3707608
Entry
3707608           CDS       T40000                                 

Gene name
I6L, VACWR075
Definition
(RefSeq) Vaccinia virus; hypothetical protein
Taxonomy
TAX:10245 [GN:T40360]
  Lineage
Viruses; dsDNA viruses; Poxviridae; Chordopoxvirinae; Orthopoxvirus
Organism
vg  Viruses (Vaccinia virus)
SSDB
Motif
Pfam: Pox_I6 DUF3746
Other DBs
NCBI-GeneID: 3707608
NCBI-ProteinID: YP_232957
RS: NC_006998
UniProt: P68462 Q76RD6 A0A0A1CV00
Position
NC_006998:complement(64525..65673)
AA seq 382 aa
MNNFVKQVASKSLKPTKKLSPSDEVISLNECIISFNLDNFYYCNDGLFTKPINTPEDVLK
SLLIMESFAYEKMIIKGLIKILISRAYINDIYFTPFGWLTGVDDDPETHVVIKIIFNSSL
ISIKSQVIEYLKPYNVNNLSVLTTEKELSINTFNVPDSIPMSIISFFPFDTDFILVILFF
GVYNDSYCGISYISPKERLPYIIEILKPLVSEINMLSDEIGRTSSIRIFNSTSVKKFPTN
TLTSICEIVYSFDESSFPTPKTFTPLNASPYIPKKIVSLLDLPSNVEIKAISRGGVDFIT
HINNKRLNTILVIAKDNFLKNSTFSGTFIKENIIWKGIYTYRIIKSSFPVPTIKSVTNKK
KICKKHCFVNSQYTTRTLSHIL
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgaataactttgttaaacaagtagcttcaaagtctctaaaacctaccaaaaaattgtct
ccgtcagatgaggtgatatctttaaacgaatgcataatatcctttaacttggataacttt
tattattgcaacgatggactgtttactaagcccattaatactccggaggatgttcttaaa
tcactcttgatcatggaatcattcgcctacgagaagatgataatcaaaggattgataaaa
atactaatatctagagcatatattaatgatatttattttactccgttcggttggttgacg
ggcgtcgacgatgatcctgaaacacacgtggtgataaaaataattttcaattcatcacta
atatctatcaagtctcaagttatagaatatttaaaaccatacaatgtcaataacctatcg
gtacttaccacagaaaaagaattaagtattaatacgttcaatgttccggattctatacct
atgtcgataatttcgtttttcccattcgatacagattttatactagttattttgtttttt
ggagtatataatgactcgtattgtggaataagctatataagtccgaaagagagactaccg
tatatcatcgaaatattaaaaccgttggtgtcggaaattaacatgttatcggatgaaata
ggtagaacatcatccattagaattttcaattccactagcgtcaaaaaatttcctactaat
acattaacatccatttgtgaaattgtttattcgtttgacgaatcatcctttccgacgccc
aagacgttcactcctctaaacgcgagtccatacattcctaaaaagatagtttcactattg
gatttaccatctaatgtggaaataaaggcgatatctagaggcggtgtggatttcatcact
catattaataataagcgtctaaacacaatcttggtaatagcaaaagataactttttaaaa
aattctacattttctggaacttttatcaaagagaatattatttggaagggtatctatact
tatagaataatcaagtctagttttccagttcctactattaagtcggttactaataaaaaa
aaaatatgtaagaaacattgttttgtcaattctcaatatacaactaggactttgtcacat
attctttga

DBGET integrated database retrieval system