KEGG   Viruses: 3707648Help
Entry
3707648           CDS       T40000                                 

Gene name
K2L, VACWR033
Definition
(RefSeq) Vaccinia virus; serine protease inhibitor-like protein
Taxonomy
TAX:10245
  Lineage
Viruses; dsDNA viruses; Poxviridae; Chordopoxvirinae; Orthopoxvirus
Taxonomy
Organism
vg  Viruses (Vaccinia virus)
SSDB OrthologParalogGFIT
Motif
Pfam: Serpin
Motif
Other DBs
NCBI-GeneID: 3707648
NCBI-ProteinID: YP_232915
RS: NC_006998
UniProt: P18384
Position
NC_006998:complement(26147..27256)
AA seq 369 aa AA seqDB search
MIALLILSLTCSVSTYRLQGFTNAGIVAYKNIQDDNIVFSPFGYSFSMFMSLLPASGNTR
IELLKTMDLRKRDLGPAFTELISGLAKLKTSKYTYTDLTYQSFVDNTVCIKPSYYQQYHR
FGLYRLNFRRDAVNKINSIVERRSGMSNVVDSNMLDNNTLWAIINTIYFKGIWQYPFDIT
KTRNASFTNKYGTKTVPMMNVVTKLQGNTITIDDEEYDMVRLPYKDANISMYLAIGDNMT
HFTDSITAAKLDYWSFQLGNKVYNLKLPKFSIENKRDIKSIAEMMAPSMFNPDNASFKHM
TRDPLYIYKMFQNAKIDVDEQGTVAEASTIMVATARSSPEKLEFNTPFVFIIRHDITGFI
LFMGKVESP
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgattgcgttattgatactatcgttaacgtgttcagtgtctacctatcgtctgcaagga
tttaccaatgccggtatagtagcgtataaaaatattcaagatgataatattgtcttctca
ccgtttggttattcgttttctatgtttatgtcgctattgcctgcatcaggtaatactaga
atagaattattgaagactatggatttgagaaaaagagatctgggtccagcatttacagaa
ttaatatcaggattagctaagctgaaaacatctaaatatacgtacactgatctaacttat
caaagtttcgtagataatactgtgtgcattaaaccgtcgtattatcaacaatatcataga
ttcggcctatatagattaaactttagacgagatgcggttaataaaattaattctatagta
gaacgtagatccggtatgtctaatgtagtagattctaatatgctcgacaataatactcta
tgggcaatcattaatactatatattttaaaggtatatggcaatatccgtttgatatcact
aaaacacgcaatgctagttttactaataagtacggtacgaaaacggttcccatgatgaac
gtagttactaaattgcaaggaaatacaatcacaatcgatgacgaagaatatgatatggta
cgccttccgtataaggatgctaatattagtatgtacctggcaataggtgataatatgacc
catttcacagattctattacggctgcaaaattagactattggtcgtttcaattagggaat
aaagtgtacaatcttaaactccctaaattttctatcgaaaataagagggatattaagtcg
atagccgaaatgatggctcctagtatgtttaatccagataatgcgtcgtttaaacatatg
actagggacccattatatatttataaaatgtttcagaatgcaaagatagatgtcgacgaa
caaggaactgtagcagaggcatctactattatggtagctacggcgagatcatctcctgaa
aaactggaatttaatacaccatttgtgttcatcatcagacatgatattactggatttata
ttgtttatgggtaaggtggaatctccttaa

DBGET integrated database retrieval system